Gene Card
Gene overview
cDNA / CDS / Protein Sequences
1744 bp · TkAUNG094260|TK1151|cDNA
TAAAAGTTAAAGCACACTAACTTTTGCAATTTCCCTTTCAAAATTAAGAGGTGCTTTGGGCCAATGTATATAAAATTATCTAAACGAAATTATAAACCAATTATTGAATACTATTTTATAATTACATAACACACTTAACTTAACCAAACAATTGTCCAATCATCTTCTTAAACATCAACAACCACATTTTAAAATCATATTGCAAACACCCTGGTTTTACATTGTTAAATGAATTTTAGTAATCAAACTTTTTTATTCCA...
822 bp · TkAUNG094260|TK1151|CDS
ATGGCAACTGCTTCTTTGGGTTCATCGACTGTAATCCAATCACAATTCCCCGGGATCACAAAGCCGTCTACCTCCCAATCTAACTCGCTCGCTTTCACAAGAAAAGCCTTTAGACCCGTCGTGAAGGCTAGCTCTCGTGTTGATAGATTCTCAAAGAGTGATATCATCGTTTCCCCATCGATTCTCTCTGCAAATTTCTCAAAGTTAGGAGAGCAGGTCAAAGCGGTTGAGGTGGCAGGTTGTGATTGGATCCACGTGGA...
Protein
Download Protein FASTA273 aa · TkAUNG094260|TK1151|PROTEIN
MATASLGSSTVIQSQFPGITKPSTSQSNSLAFTRKAFRPVVKASSRVDRFSKSDIIVSPSILSANFSKLGEQVKAVEVAGCDWIHVDVMDGRFVPNITIGPLVVDALRPVTDLPLDVHLMIVEPEQRVPDFIKAGADIVSVHCEQSSTIHLHRTVNQIKSLGAKAGVVLNPATPLTTIEYVLDVVDLVLIMSVNPGFGGQGFIESQVKKISDLKRMCIEKGVNPWIEVDGGVGPNNAYKVIEAGANALVAGSAVFGAKDY...
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | TkAUNG094260 |
|---|---|
| TK1151 ID | TkAUNG094260 |
| OH-1004 ID | LXL04_030613 |
| Relationship / confidence | Multi Source To Oh1004 / Complex relationship |
| Protein identity (%) | 99.300 |
| Protein coverage (%) | TK1151 100.000 / OH-1004 100.000Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | TK1151 / GWHBCHF00000000 |
SNP / Indel variants and carrier samplesCRA009020 · TK1151
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | TkAUNG094260 | ||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Location | ChrUn:26654060-26656510 (+) | ||||||||||||
| Description | Similar to RPE: Ribulose-phosphate 3-epimerase, chloroplastic | ||||||||||||
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene Arabidopsis
Rice
| ||||||||||||
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · | ||||||||||||
| GO annotations (OH1004 source) | GO:0005975 carbohydrate metabolic process Biological Process GO:0006098 pentose-phosphate shunt Biological Process GO:0009052 pentose-phosphate shunt, non-oxidative branch Biological Process GO:0009409 response to cold Biological Process GO:0009624 response to nematode Biological Process GO:0019253 reductive pentose-phosphate cycle Biological Process GO:0019323 pentose catabolic process Biological Process GO:0005829 cytosol Cellular Component GO:0009507 chloroplast Cellular Component GO:0009535 chloroplast thylakoid membrane Cellular Component GO:0009536 plastid Cellular Component GO:0009570 chloroplast stroma Cellular Component | ||||||||||||
| KEGG gene cross-reference | ath:AT5G61410 dosa:Os03g0169100 syn:sll0807 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF00834Ribul_P_3_epim57-255 aaPF00478IMPDH67-92 aaPF05690ThiG75-89 aaPF00478IMPDH125-258 aaPF02581TMP-TENI126-168 aaPF04131NanE128-255 aaPF00215OMPdecase163-266 aaPF05690ThiG226-268 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| TkAUNG094260 | PF00834 | Ribul_P_3_epim | 57 | 255 | 1.2e-87 | 293.2 |
| TkAUNG094260 | PF00478 | IMPDH | 67 | 92 | 0.014 | 15.1 |
| TkAUNG094260 | PF05690 | ThiG | 75 | 89 | 0.051 | 13.6 |
| TkAUNG094260 | PF00478 | IMPDH | 125 | 258 | 0.014 | 15.1 |
| TkAUNG094260 | PF02581 | TMP-TENI | 126 | 168 | 0.13 | 12.3 |
| TkAUNG094260 | PF04131 | NanE | 128 | 255 | 0.097 | 12.6 |
| TkAUNG094260 | PF00215 | OMPdecase | 163 | 266 | 0.00065 | 20.4 |
| TkAUNG094260 | PF05690 | ThiG | 226 | 268 | 0.051 | 13.6 |
| TkAUNG094260 | PF02581 | TMP-TENI | 228 | 253 | 0.13 | 12.3 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.