TkAUNG093570 | RubberDandelionOmics

Gene overview

TkAUNG093570

Reference: TK1151 Chr: ChrUn Coordinates: 26489644-26493869 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1551 bp · TkAUNG093570|TK1151|cDNA

AACAATTCCAAATTGATTAACACACTAAATAAACAAATCCAAACATCCTCTAATACAATAATACCTTTGTTTAAAAACTGTTTACTACTTATACCTTCCCTCTAACCTTGTCCAGCGAAAGGTGGAAAACATATTCCCAGGGCACTCGATAGTACAAAACTAATTCTAGACTTCTAGTTTTATCCCTTAATAATTACACAAACCAACTTATATTCTGTCTTTACTCAAAACATTCTTCCAAATTACAGATCAGAAACACT...

CDS

Download CDS FASTA

900 bp · TkAUNG093570|TK1151|CDS

ATGAAGGACGATTTGATCTTCAAGATAAAGCACCTACTCGGATCGCGTACAGTCCCAGTAATTTTCTTGAGGCGGTTCTCTTACAAGGCCATAAAGCAAGCCACAAACGGTTTCACAAGAGTTATTACGACTTCTTCCCATGGGGTTTCTTATAAAGCTGAGTTTGAAGGTGGTCATGGTGCCATGGTGAAAGAAATACATCTCATTGATCAAGAAGATGATTTTTTCTATCGCGAGGTCCAACTTTTGGGACGTTTGCA...

Protein

Download Protein FASTA

299 aa · TkAUNG093570|TK1151|PROTEIN

MKDDLIFKIKHLLGSRTVPVIFLRRFSYKAIKQATNGFTRVITTSSHGVSYKAEFEGGHGAMVKEIHLIDQEDDFFYREVQLLGRLHHRHVVTLKGFSVGRKRFLIFENVENGSLKEHLNDPLRTPLDWRIRLNIAVGVAAALEYLHFFCDPPVYHVSISSNTIMLDENLNAKLTDVGLLGSGSDQVMAWRTSSSNETTGQVYGNIMYQLGLLILELITGQSSEKTGPDLIQWIEESCFPASMDNMIDPDLGNNYDSREL...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkAUNG093570`
TK1151 ID	TkAUNG093570
OH-1004 ID	LXL04_038406
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	35.900
Protein coverage (%)	TK1151 90.301 / OH-1004 43.008 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkAUNG093570

Location ChrUn:26489644-26493869 (-)

Description Similar to At1g49730: Probable receptor-like protein kinase At1g49730

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g49730`	Probable receptor-like protein kinase At1g49730.	No verified direct reference in this release
`At3g24550`	Proline-rich receptor-like protein kinase PERK1.	No verified direct reference in this release
`At1g49270`	Proline-rich receptor-like protein kinase PERK7.	No verified direct reference in this release
`At5g38560`	Could be involved in the negative regulation of root growth.	PERK-KIPK-KCBP signalling negatively regulates root growth in Arabidopsis thaliana.2015 · DOI: 10.1093/jxb/eru390
`At1g10620`	Putative proline-rich receptor-like protein kinase PERK11.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_038406 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006952 defense response Biological Process

GO:0007165 signal transduction Biological Process

GO:0009409 response to cold Biological Process

GO:0009631 cold acclimation Biological Process

GO:0010483 pollen tube reception Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0010008 endosome membrane Cellular Component

GO:0090406 pollen tube Cellular Component

GO:0004672 protein kinase activity Molecular Function

GO:0004674 protein serine/threonine kinase activity Molecular Function

KEGG gene cross-reference

ath:AT1G49730

ath:AT3G07070

ath:AT5G38560

ath:AT5G54590

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.621

Rank 1 · TkAUNG093570 · TK1151

Cytoplasm0.260

Rank 2 · TkAUNG093570 · TK1151

Nucleus0.242

Rank 3 · TkAUNG093570 · TK1151

Endoplasmic reticulum0.042

Rank 4 · TkAUNG093570 · TK1151

Golgi apparatus0.028

Rank 5 · TkAUNG093570 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF07714PK_Tyr_Ser-Thr60-183 aa

PF00069Pkinase64-184 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkAUNG093570	`PF07714`	PK_Tyr_Ser-Thr	60	183	3e-15	56.9
TkAUNG093570	`PF00069`	Pkinase	64	184	2.3e-12	47.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FX99`	Arabidopsis thaliana	sp\|Q9FX99\|Y1497_ARATH Probable receptor-like protein kinase At1g49730	37.300%	Swiss-Prot	Medium
`Q9LV48`	Arabidopsis thaliana	sp\|Q9LV48\|PERK1_ARATH Proline-rich receptor-like protein kinase PERK1	29.800%	Swiss-Prot	Low
`Q9XI96`	Arabidopsis thaliana	sp\|Q9XI96\|PERK7_ARATH Proline-rich receptor-like protein kinase PERK7	29.500%	Swiss-Prot	Low
`Q9FFW5`	Arabidopsis thaliana	sp\|Q9FFW5\|PERK8_ARATH Proline-rich receptor-like protein kinase PERK8	28.500%	Swiss-Prot	Low
`Q9SGY7`	Arabidopsis thaliana	sp\|Q9SGY7\|PEK11_ARATH Putative proline-rich receptor-like protein kinase PERK11	29.900%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card