TkAUNG092730 | RubberDandelionOmics

Gene overview

TkAUNG092730

Reference: TK1151 Chr: ChrUn Coordinates: 26290311-26295546 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2126 bp · TkAUNG092730|TK1151|cDNA

TATAAAACTCGATTCCCATGAATCCTGGGCATTTCAATCTCCCCTGTCATCTTCATATATCTGATTCCCCTTTCCCCCCTTTTCTCTCCATCTTTTCACAGATTTCCAGTCAAAATTCTCTTGTTTCTTACTAAAAAACACGACCAAAATCGACTCTTTAAATCGCGATTTTATTCGGTGATTTTGTGTTCGAATATCGGATTAAGTATGCTAAACATCTTGCCAGATTGGTTGAAGTGCATCTATGTCGTTTTTGCCTT...

CDS

Download CDS FASTA

1704 bp · TkAUNG092730|TK1151|CDS

ATGCTAAACATCTTGCCAGATTGGTTGAAGTGCATCTATGTCGTTTTTGCCTTCTGCTCTGCTCTGTTCTTCGGTGCTCTTAAAAGTTTGTTAGTGGGTCCGATTGCTGCTTTGATTCTTATTATTGGAAATGTTGCGGTGATTTTAGCTCTTTTTCCTAATCATGTTGCCTGGACTGTTTATACTCTTCTCAAGACTAATAGATTTGATGCCCCATTAAAAGTCGCATTCTTGTTTGGATTGCCTGTTCTATTTGGGAT...

Protein

Download Protein FASTA

567 aa · TkAUNG092730|TK1151|PROTEIN

MLNILPDWLKCIYVVFAFCSALFFGALKSLLVGPIAALILIIGNVAVILALFPNHVAWTVYTLLKTNRFDAPLKVAFLFGLPVLFGIWLGLSIGGSVLVGVGYGFFAPWISSFEAFRHEDESNKFIHSIVDGTWGTIQGSCTVVRDFADLCYHSYPLYLKELRDSPSDSELRTLRFIHVPACIIVGLLGIVVDVPLYTAIAVVKSPYMLFKGWQRFIHDLISREGPFLETACIPIAGLTILVWPIVVIGSVIMAIVSSIF...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkAUNG092730`
TK1151 ID	TkAUNG092730
OH-1004 ID	LXL04_006855
Relationship / confidence	Rbh Sequence Supported / Probable
Protein identity (%)	97.500
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkAUNG092730

Location ChrUn:26290311-26295546 (+)

Description Similar to At3g27390: Uncharacterized membrane protein At3g27390

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g27390`	Uncharacterized membrane protein At3g27390.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_006855 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0016020 membrane Cellular Component

KEGG gene cross-reference

ath:AT3G27390

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.416

Rank 1 · TkAUNG092730 · TK1151

Endoplasmic reticulum0.321

Rank 2 · TkAUNG092730 · TK1151

Cytoplasm0.267

Rank 3 · TkAUNG092730 · TK1151

Golgi apparatus0.149

Rank 4 · TkAUNG092730 · TK1151

Nucleus0.129

Rank 5 · TkAUNG092730 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF28744At3g27390_N17-270 aa

PF28741At3g27390_C367-551 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkAUNG092730	`PF28744`	At3g27390_N	17	270	5.3e-115	384.1
TkAUNG092730	`PF28741`	At3g27390_C	367	551	1.2e-74	250.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8GUM4`	Arabidopsis thaliana	sp\|Q8GUM4\|Y3739_ARATH Uncharacterized membrane protein At3g27390	40.900%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card