RubberDandelionOmics Rubber Dandelion Multi-omics Website
More
Transcriptome Expression Annotation Rubber Pathway TF Prediction Targets Protein Network Resequencing Tools Downloads
ZH EN

How to use this page

Gene Card

Enter a TK1151 or OH-1004 gene ID to view sequences, annotations and analyses in the corresponding reference genome.
Flanking length, max 10000 bp
Examples TkA01G624900 LXL04_000258

Gene overview

TkAUNG092480
Reference: TK1151 Chr: ChrUn Coordinates: 26203992-26205523 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

Download cDNA FASTA

909 bp · TkAUNG092480|TK1151|cDNA

AAAAAACTAGAAACCAACTCACTGCTCAGAGTTTTAGAGGAAAAAACTGACATGTTTGTAGAGAGAGAAAGCTCAACGAACGTGACTGCGATGGAGTGTATATCACCCTTCCTCATTAATGACATTTACATTTACTCCTTTGCCACCTCCCACCTCCATTACCACATTCTTCTTCGAAAGCTCACTCATCAATACTACTACAGATTACAGATATCTTTGTTCTAGGGTTAGGGTTTTTTTATGCTTAAAAGTCTTCGAGG...

CDS

Download CDS FASTA

525 bp · TkAUNG092480|TK1151|CDS

ATGGATGGTCGTCGACATTCAGTTGACATTCCTCTTTCAAAAGCCCTGATAGCTCTTCGAAGAGTGAGATCACTTAGAGACCCATCAACGAACTCATCAAGCCGATTGGCTACTTTTGTCGACAATTTAAATTGGGAAACCGATTCCACCAATGGGATCGTTCTCGAACAAGTAAACAATCATCGCCTAAGTGACCCCACCACTTACGATTTAGGGCTATATAGAAATTGCGACCTCTATCATGGTCAAACCACACATAT...

Protein

Download Protein FASTA

175 aa · TkAUNG092480|TK1151|PROTEIN

MDGRRHSVDIPLSKALIALRRVRSLRDPSTNSSSRLATFVDNLNWETDSTNGIVLEQVNNHRLSDPTTYDLGLYRNCDLYHGQTTHIGQSGLLKPTQTPICENKSLSERYHSNYNDLPCMMPTSDYMEGTDSCNESMEVFIESERQDHNNIYKRRSRRKKHVRVSNIVGGDVISS

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

Download Gene (CDS) Download Protein

ID Mapping

Input IDTkAUNG092480
TK1151 IDTkAUNG092480
OH-1004 IDLXL04_009444
Relationship / confidenceSequence Supported Annotation Or Model Conflict / Review
Protein identity (%)100.000
Protein coverage (%)TK1151 100.000 / OH-1004 20.759
Coverage and evidence

Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.

Source versionTK1151 / GWHBCHF00000000
Open Full ID Mapping
SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene IDTkAUNG092480
LocationChrUn:26203992-26205523 (-)
DescriptionSimilar to At4g24790: Protein STICHEL-like 2
Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene IDPossible functionPapers / DOI
At4g24790 Protein STICHEL-like 2. No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source
View annotation sources

Functional annotation source: OH1004 · LXL04_009444 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)
GO:0006261 DNA-templated DNA replication Biological Process
GO:0006281 DNA repair Biological Process
GO:0010026 trichome differentiation Biological Process
GO:0010091 trichome branching Biological Process
GO:0005634 nucleus Cellular Component
GO:0005663 DNA replication factor C complex Cellular Component
GO:0005886 plasma membrane Cellular Component
GO:0009360 DNA polymerase III complex Cellular Component
GO:0003677 DNA binding Molecular Function
GO:0003887 DNA-directed DNA polymerase activity Molecular Function
GO:0005524 ATP binding Molecular Function
GO:0046872 metal ion binding Molecular Function
KEGG gene cross-reference
ath:AT1G14460
ath:AT2G02480
ath:AT4G24790
ath:AT5G45720
These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.
Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene
Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.498
Rank 1 · TkAUNG092480 · TK1151
Nucleus0.364
Rank 2 · TkAUNG092480 · TK1151
Mitochondrion0.102
Rank 3 · TkAUNG092480 · TK1151
Cell membrane0.096
Rank 4 · TkAUNG092480 · TK1151
Lysosome / Vacuole0.051
Rank 5 · TkAUNG092480 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

No result was found for this query.

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

ProteinOrganismDescriptionIdentityDatabaseConfidence
F4JRP8Arabidopsis thalianasp|F4JRP8|STIL2_ARATH Protein STICHEL-like 259.600%Swiss-ProtLow

JBrowse

View in Genome Browser