TkAUNG091530 | RubberDandelionOmics

Gene overview

TkAUNG091530

Reference: TK1151 Chr: ChrUn Coordinates: 25915245-25919321 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2211 bp · TkAUNG091530|TK1151|cDNA

TTCGCAGAAGATTAATTATGCACCCGAGGTCGATAAAGTCTGCAAAGCACTCGAGGCGGTGAATTTGAAAAGTTCAGACATATTGGATCCTCCGAATACGCAGGCAAGCAATTTGCAACGAAAGCCGGCAACACGCCCTCGCTGAAATCCTCGAAATACTCGCCGTCGTTTGCGAGACTCACAACTTCCCACTCGCCCAAACATGGGTCCCATGCCGGCACCGGAGCGTCCTCGCGTACGGCGGCGGATTCAAGAAAAGC...

CDS

Download CDS FASTA

1533 bp · TkAUNG091530|TK1151|CDS

ATGGGGCAAGTATGTATGTCGACAACCGACGTCGCGTTTTACGTCGTCGATGCTCATATGTGGGGGTTTCGCGGTGCTTGCGCCGAACATCATTTACAGAAAGGTCAAGGGGTCGCCGGAAGGGCTTTCGCGACTCGAAGTTCTTGTTTTTGTGAAAACATCACGCATTTTGGGAAAACAGAGTACCCTTTGGTTCATTATGCGCGGATGTTCGGGTTAGTTGGATCTTTCGCGATTTGTTTGAGGAGTAGTCATACCGG...

Protein

Download Protein FASTA

510 aa · TkAUNG091530|TK1151|PROTEIN

MGQVCMSTTDVAFYVVDAHMWGFRGACAEHHLQKGQGVAGRAFATRSSCFCENITHFGKTEYPLVHYARMFGLVGSFAICLRSSHTGDDDYVLEFFLPPNVVEFEDQQRMLGSLLTSMKQHFRSLKVASGEEIGEDGRMVDIIKACADGDVIDSGIQSIRLSECVVSNGGPAVGVEPLVGPSGVNGNCGKLENVEVTKKSERKRGKAEKSISLEVLQQHFVGSLKDAAKNLGVCPTTMKRICRQHGISRWPSRKINKVNR...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkAUNG091530`
TK1151 ID	TkAUNG091530
OH-1004 ID	LXL04_005733
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	99.800
Protein coverage (%)	TK1151 100.000 / OH-1004 55.435 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkAUNG091530

Location ChrUn:25915245-25919321 (+)

Description Similar to NLP7: Protein NLP7

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g24020`	Transcription factor involved in regulation of nitrate assimilation and in transduction of the nitrate signal.	The nodule inception-like protein 7 modulates nitrate sensing and metabolism in Arabidopsis.2009 · DOI: 10.1111/j.1365-313x.2008.03695.x
`At1g64530`	Probable transcription factor.	No verified direct reference in this release
`At1g76350`	Probable transcription factor.	No verified direct reference in this release
`At1g20640`	Probable transcription factor.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os01g0236700`	Probable transcription factor.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_005733 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0006355 regulation of DNA-templated transcription Biological Process

GO:0009414 response to water deprivation Biological Process

GO:0010118 stomatal movement Biological Process

GO:0010167 response to nitrate Biological Process

GO:0042128 nitrate assimilation Biological Process

GO:0005634 nucleus Cellular Component

GO:0000976 transcription cis-regulatory region binding Molecular Function

GO:0000987 cis-regulatory region sequence-specific DNA binding Molecular Function

GO:0001046 core promoter sequence-specific DNA binding Molecular Function

GO:0001216 DNA-binding transcription activator activity Molecular Function

GO:0003677 DNA binding Molecular Function

KEGG gene cross-reference

ath:AT1G64530

ath:AT1G76350

ath:AT2G17150

ath:AT4G24020

dosa:Os01g0236700

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.971

Rank 1 · TkAUNG091530 · TK1151

Cytoplasm0.079

Rank 2 · TkAUNG091530 · TK1151

Cell membrane0.030

Rank 3 · TkAUNG091530 · TK1151

Endoplasmic reticulum0.018

Rank 4 · TkAUNG091530 · TK1151

Plastid0.013

Rank 5 · TkAUNG091530 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF22922GAF_NLP3-125 aa

PF02042RWP-RK203-275 aa

PF12728HTH_17223-253 aa

PF00564PB1347-372 aa

PF05521Phage_HCP391-473 aa

PF00564PB1416-497 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkAUNG091530	`PF22922`	GAF_NLP	3	125	1.3e-55	188.3
TkAUNG091530	`PF02042`	RWP-RK	203	275	1.9e-27	95.9
TkAUNG091530	`PF12728`	HTH_17	223	253	0.024	15.6
TkAUNG091530	`PF00564`	PB1	347	372	1.7e-20	73.5
TkAUNG091530	`PF05521`	Phage_HCP	391	473	0.13	13.6
TkAUNG091530	`PF00564`	PB1	416	497	1.7e-20	73.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q84TH9`	Arabidopsis thaliana	sp\|Q84TH9\|NLP7_ARATH Protein NLP7	50.400%	Swiss-Prot	High
`Q8RWY4`	Arabidopsis thaliana	sp\|Q8RWY4\|NLP6_ARATH Protein NLP6	47.900%	Swiss-Prot	Medium
`Q9SFW8`	Arabidopsis thaliana	sp\|Q9SFW8\|NLP5_ARATH Protein NLP5	38.000%	Swiss-Prot	Medium
`Q9LE38`	Arabidopsis thaliana	sp\|Q9LE38\|NLP4_ARATH Protein NLP4	36.000%	Swiss-Prot	Medium
`Q5NB82`	Oryza sativa subsp. japonica	sp\|Q5NB82\|NLP3_ORYSJ Protein NLP3	45.500%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card