TkAUNG091470 | RubberDandelionOmics

Gene overview

TkAUNG091470

Reference: TK1151 Chr: ChrUn Coordinates: 25902759-25905215 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2085 bp · TkAUNG091470|TK1151|cDNA

CGGGAGTATTTCTTCTCGTAACGACTGGTCACCTAAAATTCATATATAGATAAAATTTGAGATGTGGCACAATCCGATTGGATTAGACATTTATACCTCATCATCCAGATAATATTCAAGCAAGATCATCAACACCCACCCGATATGTCCACACATACACACAGTGTCAAAGCTCTGCCTCTAATGGCGGTTTTCACACACTGAATGGATTCAACCACACCCCCAAATCCCACATTAACGAGCCGGATATAGAGTCACTT...

CDS

Download CDS FASTA

870 bp · TkAUNG091470|TK1151|CDS

ATGGCTCCAGCTCTCACCTCTAATTCCTTTCTCCTGACCACAACACCTCGCACAAGTCTCGCTTCCCTCAAAAACCCTAGGAGACTAATCGTCTGTGCGAAGAAATCCGATGTATCTTCTGGTGGAGAAGGCGAAACCGAGAATTCGAATCGATTTCGGTTCAATTTCGACTTCGGGAAGGTTTCTGATATGAAATCGTTGATTCCAGTTGTGAGCAATCCCTCATCATCGGGTACGTTATTTGGTAGACGTAAGGATCC...

Protein

Download Protein FASTA

289 aa · TkAUNG091470|TK1151|PROTEIN

MAPALTSNSFLLTTTPRTSLASLKNPRRLIVCAKKSDVSSGGEGETENSNRFRFNFDFGKVSDMKSLIPVVSNPSSSGTLFGRRKDPNTVFVAGATGQAGLRIAQTLLREGFSVRAGVPELSAAQDLARLAVNYKVISLEESKRLNAVESTFQDPEAIAKAIGNATKAVVTIGPFENGPTAEVTTSEALQFIQAAQLAGVSHVAIIYDTAAQAFTSTNNVLDGISTFFNNLFTKSQPLTLKEFLDGLIATDVNYTLIKTK...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkAUNG091470`
TK1151 ID	TkAUNG091470
OH-1004 ID	LXL04_000565
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	99.700
Protein coverage (%)	TK1151 99.654 / OH-1004 57.256 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkAUNG091470

Location ChrUn:25902759-25905215 (-)

Description Similar to PTAC16: Protein PLASTID TRANSCRIPTIONALLY ACTIVE 16, chloroplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g46780`	Probably involved in the regulation of plastid gene expression.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_000565 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0007623 circadian rhythm Biological Process

GO:0015031 protein transport Biological Process

GO:0005783 endoplasmic reticulum Cellular Component

GO:0005829 cytosol Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0009534 chloroplast thylakoid Cellular Component

GO:0009535 chloroplast thylakoid membrane Cellular Component

GO:0009570 chloroplast stroma Cellular Component

GO:0009706 chloroplast inner membrane Cellular Component

GO:0009941 chloroplast envelope Cellular Component

GO:0010287 plastoglobule Cellular Component

GO:0042644 chloroplast nucleoid Cellular Component

KEGG gene cross-reference

ath:AT2G34460

ath:AT3G18890

ath:AT3G46780

dosa:Os10g0100300

osa:4347935

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.986

Rank 1 · TkAUNG091470 · TK1151

Mitochondrion0.020

Rank 2 · TkAUNG091470 · TK1151

Nucleus0.017

Rank 3 · TkAUNG091470 · TK1151

Cytoplasm0.015

Rank 4 · TkAUNG091470 · TK1151

Cell membrane0.014

Rank 5 · TkAUNG091470 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF05368NmrA88-203 aa

PF01370Epimerase90-189 aa

PF16363GDP_Man_Dehyd91-165 aa

PF13548DUF412693-129 aa

PF13460NAD_binding_1094-278 aa

PF13548DUF4126183-229 aa

PF16363GDP_Man_Dehyd197-214 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkAUNG091470	`PF05368`	NmrA	88	203	2.6e-07	31.3
TkAUNG091470	`PF01370`	Epimerase	90	189	0.0063	16.7
TkAUNG091470	`PF16363`	GDP_Man_Dehyd	91	165	0.0098	16.1
TkAUNG091470	`PF13548`	DUF4126	93	129	0.048	14.1
TkAUNG091470	`PF13460`	NAD_binding_10	94	278	2e-10	41.5
TkAUNG091470	`PF13548`	DUF4126	183	229	0.048	14.1
TkAUNG091470	`PF16363`	GDP_Man_Dehyd	197	214	0.0098	16.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9STF2`	Arabidopsis thaliana	sp\|Q9STF2\|PTA16_ARATH Protein PLASTID TRANSCRIPTIONALLY ACTIVE 16, chloroplastic	58.300%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card