TkAUNG090680 | RubberDandelionOmics

Gene overview

TkAUNG090680

Reference: TK1151 Chr: ChrUn Coordinates: 25726157-25733048 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1213 bp · TkAUNG090680|TK1151|cDNA

ATAACTAGACGTATCAGAGATCACAGCAAACAAATTCGAGTAAGTTGCTGCTTCAATTTCTCGAGCAATTTTTCTTTCTCCTTGTGTCAAACCGTGATTTTCACATGTTTCTGTATTAACGTACGCATGTCTCATATATGCTATGTGGATTGTTGAACTTTGACGTATTCTGGATTTTAATTCCATCGAGCAATCTGTTTGCTCCACTGCCTAGGGTTTTTCTAACCTGTAAAAAGTTGAAACTTGAACTGGTTCCAAAT...

CDS

Download CDS FASTA

531 bp · TkAUNG090680|TK1151|CDS

ATGGAAGACGACGTCCGTCGAATGTCGACTCGAGCACGTAAAGTTGCACCCAAAATGGTAGCTGCACTTTCCAGCACTGATAATCGAACTCAGGCAATTCTCGCACGTCTTGAAGCTCTCGAGAATGACAATCCTGGAGCAGAACTGGTAGAACCTAATGATGATGATGATGATGCATCCCTTGATGAAGATGATGATCAAGTTTTATCATCTTTTGTAGTGTTCCAGAAAAAGCAATCGAAAGGTACGAAACGCAAAAC...

Protein

Download Protein FASTA

176 aa · TkAUNG090680|TK1151|PROTEIN

MEDDVRRMSTRARKVAPKMVAALSSTDNRTQAILARLEALENDNPGAELVEPNDDDDDASLDEDDDQVLSSFVVFQKKQSKGTKRKTRQAKALETAKKAPRTFLELLHDANLESLPPHVPSYLRAAVGPPSSTSRRHFCTVCGFSAKYTCVRCGMRFCAARCQNVHNDTRCLKFVA

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkAUNG090680`
TK1151 ID	TkAUNG090680
OH-1004 ID	LXL04_024012
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	93.200
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkAUNG090680

Location ChrUn:25726157-25733048 (-)

Description Similar to SWC6: SWR1 complex subunit 6

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g37055`	Component of the SWR1 complex which mediates the ATP- dependent exchange of histone H2A for the H2A variant H2A.F/Z leading to transcriptional regulation of selected genes (e.g. FLC) by chromatin remodeling.	SEF, a new protein required for flowering repression in Arabidopsis, interacts with PIE1 and ARP6.2007 · DOI: 10.1104/pp.106.092270 Arabidopsis homologs of components of the SWR1 complex regulate flowering and plant development.2007 · DOI: 10.1242/dev.001891

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_024012 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0000122 negative regulation of transcription by RNA polymerase II Biological Process

GO:0003015 heart process Biological Process

GO:0006338 chromatin remodeling Biological Process

GO:0006355 regulation of DNA-templated transcription Biological Process

GO:0009908 flower development Biological Process

GO:0009909 regulation of flower development Biological Process

GO:0030154 cell differentiation Biological Process

GO:0036335 intestinal stem cell homeostasis Biological Process

GO:0042742 defense response to bacterium Biological Process

GO:0045815 transcription initiation-coupled chromatin remodeling Biological Process

GO:0048638 regulation of developmental growth Biological Process

GO:0055074 calcium ion homeostasis Biological Process

KEGG gene cross-reference

ath:AT5G37055

bta:514997

ddi:DDB_G0284961

hsa:10467

mmu:70103

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.946

Rank 1 · TkAUNG090680 · TK1151

Cytoplasm0.160

Rank 2 · TkAUNG090680 · TK1151

Mitochondrion0.019

Rank 3 · TkAUNG090680 · TK1151

Cell membrane0.011

Rank 4 · TkAUNG090680 · TK1151

Endoplasmic reticulum0.007

Rank 5 · TkAUNG090680 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF04438zf-HIT135-163 aa

PF22586ANCHR-like_BBOX138-167 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkAUNG090680	`PF04438`	zf-HIT	135	163	4.6e-10	39.8
TkAUNG090680	`PF22586`	ANCHR-like_BBOX	138	167	2.3	9.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FHW2`	Arabidopsis thaliana	sp\|Q9FHW2\|SWC6_ARATH SWR1 complex subunit 6	65.100%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card