Gene Card
Gene overview
cDNA / CDS / Protein Sequences
2508 bp · TkAUNG090230|TK1151|cDNA
TTAACGATCACATTGAGGATTTCATATGCTAGTTGTTGCATAGTGAATTGGGATGATTTCATAAGCCTTCATCGTTAACTTTAGTATCAGATTGCGTATTTATAGTTTTGCTTAATCTTATTGATCTAGATTTTGGTAATGGGTTTTATCTTTGGCTTTGATGATGGAATCAATAAGGGTCACACGATGCTAATGAACTTCTCGTTCAAATAGATTCGTACAAAAAAAAGATCAACTTAAATTTGTAAAAAATTGAGATA...
1470 bp · TkAUNG090230|TK1151|CDS
ATGGAATCGATCTATGGAGAGAACATATTCATCCTTGACAAACAAAGTGGGTTGCGATCTTTTCAGATTCATATTTACATTGAAACCCCCGAAGAACTAACAATCTCCACAAACTTAAACTCTAATAATTCACAAGAATTTTCCTACTCTTTCAAAGTCCAATACCTCCCTCCAATAATCCTAACATGTTTATTACCAAAATCATACCCTACCCACCTCCCTCCATATTTCACAATCTCCACACAATGGTTAAACTCTTC...
Protein
Download Protein FASTA489 aa · TkAUNG090230|TK1151|PROTEIN
MESIYGENIFILDKQSGLRSFQIHIYIETPEELTISTNLNSNNSQEFSYSFKVQYLPPIILTCLLPKSYPTHLPPYFTISTQWLNSSKISTLCSMLDSIWKEQLGQEVIYSWTEWLHTSSLSYLGFTKEVILGPYSKKNYNNDPRAISGCVSPDLDVPSLKSYNDNKKIEDFLKNFHECCICFSEFAGTDFIRLPCQHFFCEKCMKTYANIHIHEGTVTKLSCPSSKCGGMMPPGLLKRLLGDEEFEKWESLMLQKTLES...
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | TkAUNG090230 |
|---|---|
| TK1151 ID | TkAUNG090230 |
| OH-1004 ID | LXL04_026123 |
| Relationship / confidence | Rbh Below Probable Coverage Or Synteny Threshold / Review |
| Protein identity (%) | 99.600 |
| Protein coverage (%) | TK1151 92.025 / OH-1004 67.620Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | TK1151 / GWHBCHF00000000 |
SNP / Indel variants and carrier samplesCRA009020 · TK1151
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | TkAUNG090230 |
|---|---|
| Location | ChrUn:25616888-25620064 (-) |
| Description | Similar to Rnf14: E3 ubiquitin-protein ligase RNF14 |
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene ArabidopsisNo hit for this species in the current source table. RiceNo hit for this species in the current source table. |
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · |
| GO annotations (OH1004 source) | GO:0006351 DNA-templated transcription Biological Process GO:0006355 regulation of DNA-templated transcription Biological Process GO:0006357 regulation of transcription by RNA polymerase II Biological Process GO:0006414 translational elongation Biological Process GO:0006415 translational termination Biological Process GO:0006449 regulation of translational termination Biological Process GO:0006511 ubiquitin-dependent protein catabolic process Biological Process GO:0007165 signal transduction Biological Process GO:0016567 protein ubiquitination Biological Process GO:0030521 androgen receptor signaling pathway Biological Process GO:0045893 positive regulation of DNA-templated transcription Biological Process GO:0060765 regulation of androgen receptor signaling pathway Biological Process |
| KEGG gene cross-reference | dre:415177 hsa:9604 mmu:56736 sce:YML068W spo:2543264 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF05773RWD1-118 aaPF01363FYVE176-212 aaPF13639zf-RING_2178-224 aaPF14634zf-RING_5178-224 aaPF17123zf-RING_11178-204 aaPF13923zf-C3HC4_2178-208 aaPF26148VPS18_RING_C178-206 aaPF00097zf-C3HC4179-224 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| TkAUNG090230 | PF05773 | RWD | 1 | 118 | 3.1e-19 | 69.9 |
| TkAUNG090230 | PF01363 | FYVE | 176 | 212 | 0.0073 | 17.1 |
| TkAUNG090230 | PF13639 | zf-RING_2 | 178 | 224 | 1.5e-05 | 25.9 |
| TkAUNG090230 | PF14634 | zf-RING_5 | 178 | 224 | 0.0016 | 19.1 |
| TkAUNG090230 | PF17123 | zf-RING_11 | 178 | 204 | 0.0062 | 16.9 |
| TkAUNG090230 | PF13923 | zf-C3HC4_2 | 178 | 208 | 0.0092 | 16.5 |
| TkAUNG090230 | PF26148 | VPS18_RING_C | 178 | 206 | 0.048 | 14.5 |
| TkAUNG090230 | PF00097 | zf-C3HC4 | 179 | 224 | 0.0019 | 18.8 |
| TkAUNG090230 | PF13445 | zf-RING_UBOX | 179 | 224 | 0.0019 | 18.9 |
| TkAUNG090230 | PF01485 | IBR | 195 | 208 | 4e-15 | 56.3 |
| TkAUNG090230 | PF22191 | IBR_1 | 196 | 209 | 2e-09 | 37.9 |
| TkAUNG090230 | PF01485 | IBR | 220 | 233 | 4e-15 | 56.3 |
| TkAUNG090230 | PF01485 | IBR | 247 | 306 | 4e-15 | 56.3 |
| TkAUNG090230 | PF01363 | FYVE | 261 | 301 | 0.0073 | 17.1 |
| TkAUNG090230 | PF22191 | IBR_1 | 264 | 301 | 2e-09 | 37.9 |
| TkAUNG090230 | PF14634 | zf-RING_5 | 267 | 306 | 0.0016 | 19.1 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.
No result was found for this query.