TkAUNG088470 | RubberDandelionOmics

Gene overview

TkAUNG088470

Reference: TK1151 Chr: ChrUn Coordinates: 25095625-25100579 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2673 bp · TkAUNG088470|TK1151|cDNA

CCACCACCACCAACACCAACACCAACACGAAGACGTAAGCAAGAAGAACCGAAAAGAACTCGCTTTCTCTCTCTTTCGGTCGCCGACTCACCAGTCTCCCCATTCGCTAAAACCAAGACTGATGCAAATTAGGACGATTCAATATTCACATTCACCTCTCAATCACGGGCTCTAAGTCTCTTTCTGTGTCTCTACTCTCGCAGCAAACATCAAATAGATGTACTCCCTCCTTCCTGAAAGAAATGCAAACTCAGGGTTGT...

CDS

Download CDS FASTA

1971 bp · TkAUNG088470|TK1151|CDS

ATGTCTAGAAACACATCAAGTTCCGGTGCTCTCTCACACGCATACATCCAGTATCCACCCTTAAGATGCAAAAACAACGGTTCAAGAGGCTTATTTTATGATGATGGAAATAAACTATTAATCTCACCAACTTCTAACCAGGTTGTTTGTTGGAAAACTAGTCCTTTTACTCCTACTGTTGGCTCAACAAGTGATACAATAAGTGAAGGGCCTGTACTTTCTGTCCGCTATTCTTTAGATACAAAGATTATAGCTGTTCA...

Protein

Download Protein FASTA

656 aa · TkAUNG088470|TK1151|PROTEIN

MSRNTSSSGALSHAYIQYPPLRCKNNGSRGLFYDDGNKLLISPTSNQVVCWKTSPFTPTVGSTSDTISEGPVLSVRYSLDTKIIAVQRSNHEVQFWVKETGDTFSQKSKSESDVILGFFWTDCAVCDIVFVKTSGLDFYTYVPELKSLDLVDTKKMNVSWYIYTHESRLVLLASGMQCKSFTGYQLSSAGIIRLPRFEMAMAKSDANSKPVLAAEDVHIVTVYGRIYCLQVDRVAMLLHSYRFYRDAVIQQGSLPVYSTK...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkAUNG088470`
TK1151 ID	TkAUNG088470
OH-1004 ID	LXL04_020170
Relationship / confidence	Rbh Sequence Supported / Probable
Protein identity (%)	99.700
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkAUNG088470`
Location	ChrUn:25095625-25100579 (-)
Description	Similar to RMC1: Regulator of MON1-CCZ1 complex
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_020170` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0006914 autophagy Biological Process GO:0010506 regulation of autophagy Biological Process GO:0032511 late endosome to vacuole transport via multivesicular body sorting pathway Biological Process GO:0005765 lysosomal membrane Cellular Component GO:0005770 late endosome Cellular Component GO:0031902 late endosome membrane Cellular Component GO:0035658 Mon1-Ccz1 complex Cellular Component GO:0005091 guanyl-nucleotide exchange factor adaptor activity Molecular Function
KEGG gene cross-reference	ddi:DDB_G0286707 dme:Dmel_CG8270 hsa:29919 mmu:76482 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.472

Rank 1 · TkAUNG088470 · TK1151

Nucleus0.373

Rank 2 · TkAUNG088470 · TK1151

Golgi apparatus0.134

Rank 3 · TkAUNG088470 · TK1151

Lysosome / Vacuole0.102

Rank 4 · TkAUNG088470 · TK1151

Cell membrane0.075

Rank 5 · TkAUNG088470 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF21029RMC1_N31-148 aa

PF23381Beta-prop_IFT122_1st33-115 aa

PF24817WD40_WDHD1_1st37-132 aa

PF24807WD40_CDC20-Fz44-114 aa

PF25174Beta-prop_THOC347-122 aa

PF24807WD40_CDC20-Fz121-173 aa

PF30152IN080_4174-194 aa

PF07035RMC1_C439-627 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkAUNG088470	`PF21029`	RMC1_N	31	148	1e-33	116.6
TkAUNG088470	`PF23381`	Beta-prop_IFT122_1st	33	115	0.0058	16.7
TkAUNG088470	`PF24817`	WD40_WDHD1_1st	37	132	0.12	12.2
TkAUNG088470	`PF24807`	WD40_CDC20-Fz	44	114	0.13	12.2
TkAUNG088470	`PF25174`	Beta-prop_THOC3	47	122	0.027	14.2
TkAUNG088470	`PF24807`	WD40_CDC20-Fz	121	173	0.13	12.2
TkAUNG088470	`PF30152`	IN080_4	174	194	0.19	12.0
TkAUNG088470	`PF07035`	RMC1_C	439	627	1.6e-43	149.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card