TkAUNG087330 | RubberDandelionOmics

Gene overview

TkAUNG087330

Reference: TK1151 Chr: ChrUn Coordinates: 24841806-24843918 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1878 bp · TkAUNG087330|TK1151|cDNA

TGATATATTATCCAGAAAGAAAAAAGAGGAAATCCGACATGTTCTTTTCCCAAACAAAAAGCCATCGTTCACGATATCGTACAACCCGTCATTGCACACACAAGCACGCCAGAGGTCAGACCTCCATATCTGACAGCGCTGATTCTCTGTAAGAGATCCCTTTCTTCATTGCCATCAGCTCAATCTTCCAGCTACCACTTTCATGTGATTTTCCCCCTCTATTCGCCATTTCTCTGGGGTTTGCAGAAGAAATTACATGT...

CDS

Download CDS FASTA

1392 bp · TkAUNG087330|TK1151|CDS

ATGTCTGTGTGCTGTGGAGTTGAGTGCTTTTTCGCTTTAGGCTGTCTCCGATGGGCATGGAAGCGGTGTACTTACGTTGGCGGCGACGACAGTGCCACTTGGCCACCAGCCACCGTCGAAGAATTCGAATCCGTCCCACACCTCTGCCGCGTCATCCTCGCCGTATACGAAGAAGATCTCCACCACCCCAAATTCCCACCACTTGGTGGATACCGTTTAAACCCCGATTACGTCGTCAAACGAGTTACCTACCAGGAAAC...

Protein

Download Protein FASTA

463 aa · TkAUNG087330|TK1151|PROTEIN

MSVCCGVECFFALGCLRWAWKRCTYVGGDDSATWPPATVEEFESVPHLCRVILAVYEEDLHHPKFPPLGGYRLNPDYVVKRVTYQETLGHAPPHLIYLDHTRREIVLAIRGLNLKKESDYKLLLNNRLGMQMFDGGYVHHGLLQSAIWLLNQESENLKRLWVENGSCYKMIFVGHSLGSGVAALMTVIVVNHRDMLGGIPRDLVRCYALAPARSMSLNLAVKYADVIYSVVLQDDFLPRTATPLEDIFKSIFCLPCLIFM...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkAUNG087330`
TK1151 ID	TkAUNG087330
OH-1004 ID	LXL04_024885
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	99.600
Protein coverage (%)	TK1151 100.000 / OH-1004 92.048 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkAUNG087330`
Location	ChrUn:24841806-24843918 (-)
Description	Protein of unknown function
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_024885` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0019369 arachidonate metabolic process Biological Process GO:0045471 response to ethanol Biological Process GO:0046340 diacylglycerol catabolic process Biological Process GO:0071926 endocannabinoid signaling pathway Biological Process GO:1901696 cannabinoid biosynthetic process Biological Process GO:0005886 plasma membrane Cellular Component GO:0031901 early endosome membrane Cellular Component GO:0004465 lipoprotein lipase activity Molecular Function GO:0016787 hydrolase activity Molecular Function GO:0046872 metal ion binding Molecular Function GO:0047372 monoacylglycerol lipase activity Molecular Function
KEGG gene cross-reference	hsa:747 mmu:269060 rno:309207 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.336

Rank 1 · TkAUNG087330 · TK1151

Cell membrane0.239

Rank 2 · TkAUNG087330 · TK1151

Nucleus0.215

Rank 3 · TkAUNG087330 · TK1151

Endoplasmic reticulum0.187

Rank 4 · TkAUNG087330 · TK1151

Golgi apparatus0.130

Rank 5 · TkAUNG087330 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF03893Lipase3_N7-72 aa

PF26363Phospholipase-like101-131 aa

PF01764Lipase_3106-242 aa

PF26363Phospholipase-like168-188 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkAUNG087330	`PF03893`	Lipase3_N	7	72	2.7e-19	69.7
TkAUNG087330	`PF26363`	Phospholipase-like	101	131	0.28	11.1
TkAUNG087330	`PF01764`	Lipase_3	106	242	1.4e-22	80.8
TkAUNG087330	`PF26363`	Phospholipase-like	168	188	0.28	11.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card