TkAUNG086010 | RubberDandelionOmics

Gene overview

TkAUNG086010

Reference: TK1151 Chr: ChrUn Coordinates: 24503480-24506702 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1787 bp · TkAUNG086010|TK1151|cDNA

CAGAGACCCATCAGATATTATATATAAACAAACAGTACATATAAAGTCTGTATATATAGATTCATATAAGATCTTAAATGGAAGCAAATGAGAGCCATAGATAGGAAAGGTGATAGCATAACCACAACACAAGGACAAAGATCTGAATATATTCAGACGACGTGGGACATCTTATCTCCTCAAGAACACCTTCACAACCTTCAATTCCACACAGACACTTTCTCTCTGGGTTTTCGATTTCATCATCATCATCATCATCT...

CDS

Download CDS FASTA

1317 bp · TkAUNG086010|TK1151|CDS

ATGGCGACCTGGGTGTTATCAGAATGTGGATTAAGACCACTTCCCAGACTATATTCTAATCCCAGAACACGAATCACGAGTTCGAGCTTTCCGAATTCCGTCAGACTAGCTCCGGCGAAGATTTTCCGGCCGAATTCATCGGTTTCAAGAGATAGGAGGTGGGGACTGAAGGTGAGTGCGCCGGTGGGGGTTCAATTTGTGGAAGAAGATGAAGAAAGAGTGAATGAGATTACCGCCGGAGAAAGTGAGTTCAACCCCGG...

Protein

Download Protein FASTA

438 aa · TkAUNG086010|TK1151|PROTEIN

MATWVLSECGLRPLPRLYSNPRTRITSSSFPNSVRLAPAKIFRPNSSVSRDRRWGLKVSAPVGVQFVEEDEERVNEITAGESEFNPGAPPPFTLADIRAAIPKHCWVKNPWKSMSYVVRDVVVVFGLAAVAAYYNNMVVWPLYWAAQGTMFWALFVLGHDCGHGSFSNNAKLNSVVGHLLHSSILVPYHGWRISHRTHHQNHGHVENDESWHPLSEKIYRSLDTATRMLRFTLPFPMLAYPFYLWGRSPGKKGSHFHPDS...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkAUNG086010`
TK1151 ID	TkAUNG086010
OH-1004 ID	LXL04_021846
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	99.800
Protein coverage (%)	TK1151 95.205 / OH-1004 99.050 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkAUNG086010

Location ChrUn:24503480-24506702 (-)

Description Similar to FAD7: Omega-3 fatty acid desaturase, chloroplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g05580`	Chloroplast omega-3 fatty acid desaturase introduces the third double bond in the biosynthesis of 16:3 and 18:3 fatty acids, important constituents of plant membranes.	Cloning of a temperature-regulated gene encoding a chloroplast omega-3 desaturase from Arabidopsis thaliana.1994 · DOI: 10.1104/pp.106.4.1615
`At3g11170`	Chloroplast omega-3 fatty acid desaturase introduces the third double bond in the biosynthesis of 16:3 and 18:3 fatty acids, important constituents of plant membranes.	A gene encoding a chloroplast omega-3 fatty acid desaturase complements alterations in fatty acid desaturation and chloroplast copy number of the fad7 mutant of Arabidopsis thaliana.1993 · DOI: 10.1016/s0021-9258(20)80498-0

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_021846 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006633 fatty acid biosynthetic process Biological Process

GO:0006636 unsaturated fatty acid biosynthetic process Biological Process

GO:0009266 response to temperature stimulus Biological Process

GO:0009409 response to cold Biological Process

GO:0005829 cytosol Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0009706 chloroplast inner membrane Cellular Component

GO:0009941 chloroplast envelope Cellular Component

GO:0031969 chloroplast membrane Cellular Component

GO:0042170 plastid membrane Cellular Component

GO:0016491 oxidoreductase activity Molecular Function

KEGG gene cross-reference

ath:AT3G11170

ath:AT5G05580

rcu:8265360

sind:105167042

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.946

Rank 1 · TkAUNG086010 · TK1151

Mitochondrion0.034

Rank 2 · TkAUNG086010 · TK1151

Endoplasmic reticulum0.026

Rank 3 · TkAUNG086010 · TK1151

Golgi apparatus0.018

Rank 4 · TkAUNG086010 · TK1151

Cell membrane0.016

Rank 5 · TkAUNG086010 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF11960DUF34741-129 aa

PF17332DUF5592115-156 aa

PF00487FA_desaturase140-392 aa

PF17332DUF5592281-315 aa

PF30649ABC1_C281-310 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkAUNG086010	`PF11960`	DUF3474	1	129	1.7e-53	181.3
TkAUNG086010	`PF17332`	DUF5592	115	156	0.16	13.2
TkAUNG086010	`PF00487`	FA_desaturase	140	392	7.2e-32	111.8
TkAUNG086010	`PF17332`	DUF5592	281	315	0.16	13.2
TkAUNG086010	`PF30649`	ABC1_C	281	310	0.25	11.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`P48622`	Arabidopsis thaliana	sp\|P48622\|FAD3D_ARATH Temperature-sensitive sn-2 acyl-lipid omega-3 desaturase (ferredoxin), chloroplastic	74.400%	Swiss-Prot	High
`P46310`	Arabidopsis thaliana	sp\|P46310\|FAD3C_ARATH sn-2 acyl-lipid omega-3 desaturase (ferredoxin), chloroplastic	73.300%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card