TkAUNG085600 | RubberDandelionOmics

Gene overview

TkAUNG085600

Reference: TK1151 Chr: ChrUn Coordinates: 24360648-24361175 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

528 bp · TkAUNG085600|TK1151|cDNA

ATGGAGGTTAAATCCAGAAACGATCAACTACAAGCCATCTTATTCGCCGCCGGCACGGCGGTCGTAATCGCCTGCCTTGAACGCGCCGTCGTAGTGTCGATCTTTAAGCAGTGGCATATGTGGGTGTTCCTCGCACTCAACCTCTTGCTCATCGCTATACTCTTCACATCAACTCACCCACCTCGGAATTCGTCTAACCCACCTTCAAAATCACAAGAAATCGACGAGACAAGCAAATCAGAGCCGCCTGCGACGACGGC...

CDS

Download CDS FASTA

528 bp · TkAUNG085600|TK1151|CDS

ATGGAGGTTAAATCCAGAAACGATCAACTACAAGCCATCTTATTCGCCGCCGGCACGGCGGTCGTAATCGCCTGCCTTGAACGCGCCGTCGTAGTGTCGATCTTTAAGCAGTGGCATATGTGGGTGTTCCTCGCACTCAACCTCTTGCTCATCGCTATACTCTTCACATCAACTCACCCACCTCGGAATTCGTCTAACCCACCTTCAAAATCACAAGAAATCGACGAGACAAGCAAATCAGAGCCGCCTGCGACGACGGC...

Protein

Download Protein FASTA

175 aa · TkAUNG085600|TK1151|PROTEIN

MEVKSRNDQLQAILFAAGTAVVIACLERAVVVSIFKQWHMWVFLALNLLLIAILFTSTHPPRNSSNPPSKSQEIDETSKSEPPATTAAAAADNHREDVAEDEVSLSGEDTEYEDSFEDKEEEKSESLLSNEELNEKVEAFISRFRQQYLVSDVKISRARSENVCRSGVFSKTITV

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkAUNG085600`
TK1151 ID	TkAUNG085600
OH-1004 ID	LXL04_006193
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	99.400
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkAUNG085600`
Location	ChrUn:24360648-24361175 (+)
Description	Protein of unknown function
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_006193` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	No functional description available
KEGG gene cross-reference	No functional description available

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.436

Rank 1 · TkAUNG085600 · TK1151

Nucleus0.313

Rank 2 · TkAUNG085600 · TK1151

Endoplasmic reticulum0.243

Rank 3 · TkAUNG085600 · TK1151

Cytoplasm0.185

Rank 4 · TkAUNG085600 · TK1151

Lysosome / Vacuole0.069

Rank 5 · TkAUNG085600 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF18967PycTM10-106 aa

PF22251PFF1_TM35-135 aa

PF09911DUF214037-79 aa

PF06679DUF118041-108 aa

PF04277OAD_gamma42-90 aa

PF09911DUF2140111-147 aa

PF12095CRR7120-158 aa

PF05553DUF761131-147 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkAUNG085600	`PF18967`	PycTM	10	106	0.052	14.1
TkAUNG085600	`PF22251`	PFF1_TM	35	135	0.041	14.2
TkAUNG085600	`PF09911`	DUF2140	37	79	0.15	12.2
TkAUNG085600	`PF06679`	DUF1180	41	108	0.12	13.5
TkAUNG085600	`PF04277`	OAD_gamma	42	90	0.11	13.9
TkAUNG085600	`PF09911`	DUF2140	111	147	0.15	12.2
TkAUNG085600	`PF12095`	CRR7	120	158	0.044	14.9
TkAUNG085600	`PF05553`	DUF761	131	147	0.00019	21.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card