TkAUNG081560 | RubberDandelionOmics

Gene overview

TkAUNG081560

Reference: TK1151 Chr: ChrUn Coordinates: 23226931-23230493 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2979 bp · TkAUNG081560|TK1151|cDNA

TTATAATGGTTCTAAGCATATGCAGAAATAACCGTTAAAACCTGAAAGAAGGCGGGTTAAAACGGTAGCTACTCGTTCTAGGATACCCCTATAAATAAAGTAACCTTATCTTGCATTTGCAATCTTAAACCCTCTTTCAGAGGGCCCTAAAACCCCATTCAAACCTTATCTCCGGCGCTTTGCAACTTCTCCGACCACAACAGCCACCTCCTATCGGCAAGTTCCGGTTTCCATTGCCGCCGTAGCATGCCAGTAAAACT...

CDS

Download CDS FASTA

1998 bp · TkAUNG081560|TK1151|CDS

ATGCCAGTAAAACTCCTTTCAGTGCCGGACCTCCATCTGCTCAACTCTTCTTCACTCCCGGTAACTCTTATCACCATGAAAACCAACTCCTCATTATCCAGATCCGCCCCTTTTTTTACTCGTGTCTTTCCAGATAAAATAAACTTCCAATCTCTATCATCCTCCAACAACCTAGGGTTTCCGAAACTGATGACAACTCCCCAGCCGCAGCTACATGTTTCCACCAAGGTTTCCAACCACGGGTCTGAAATTAGGGCTGC...

Protein

Download Protein FASTA

665 aa · TkAUNG081560|TK1151|PROTEIN

MPVKLLSVPDLHLLNSSSLPVTLITMKTNSSLSRSAPFFTRVFPDKINFQSLSSSNNLGFPKLMTTPQPQLHVSTKVSNHGSEIRAAKSLIEDESEVSDWFSESNSSSFKKRQVYGESDDGGNDRRSSDRGGRGGGGGGSGMNRRSDDYNGGYRGGGNRGSFGGSSRGGGNRGSFSGSSSGGGNRGSFSGSSRGGGSRGSFSGSSRGGGNRGSFSGSSRGGGNRSSYSDNPREGSLRSSFGSSSRGNGRFGGEYGNRDEA...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkAUNG081560`
TK1151 ID	TkAUNG081560
OH-1004 ID	LXL04_026653
Relationship / confidence	Rbh Sequence Supported / Probable
Protein identity (%)	96.500
Protein coverage (%)	TK1151 100.000 / OH-1004 76.451 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkAUNG081560

Location ChrUn:23226931-23230493 (+)

Description Similar to RH31: DEAD-box ATP-dependent RNA helicase 31

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g08610`	DEAD-box ATP-dependent RNA helicase 26.	No verified direct reference in this release
`At5g63630`	DEAD-box ATP-dependent RNA helicase 31.	No verified direct reference in this release
`At5g08620`	DEAD-box ATP-dependent RNA helicase 25.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os06g0526600`	DEAD-box ATP-dependent RNA helicase 31.	No verified direct reference in this release
`Os01g0618400`	DEAD-box ATP-dependent RNA helicase 25.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_026653 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0009409 response to cold Biological Process

GO:0009414 response to water deprivation Biological Process

GO:0009651 response to salt stress Biological Process

GO:0005634 nucleus Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0003723 RNA binding Molecular Function

GO:0003724 RNA helicase activity Molecular Function

GO:0003729 mRNA binding Molecular Function

GO:0005524 ATP binding Molecular Function

GO:0016887 ATP hydrolysis activity Molecular Function

KEGG gene cross-reference

ath:AT5G08610

ath:AT5G08620

ath:AT5G63630

dosa:Os01g0618400

dosa:Os06g0526600

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.912

Rank 1 · TkAUNG081560 · TK1151

Mitochondrion0.069

Rank 2 · TkAUNG081560 · TK1151

Nucleus0.052

Rank 3 · TkAUNG081560 · TK1151

Cytoplasm0.025

Rank 4 · TkAUNG081560 · TK1151

Peroxisome0.013

Rank 5 · TkAUNG081560 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF04889Cwf_Cwc_15356-379 aa

PF04851ResIII365-391 aa

PF00270DEAD432-608 aa

PF04851ResIII442-602 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkAUNG081560	`PF04889`	Cwf_Cwc_15	356	379	1.3	9.5
TkAUNG081560	`PF04851`	ResIII	365	391	2.1e-06	28.5
TkAUNG081560	`PF00270`	DEAD	432	608	2e-44	152.0
TkAUNG081560	`PF04851`	ResIII	442	602	2.1e-06	28.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FNM7`	Arabidopsis thaliana	sp\|Q9FNM7\|RH26_ARATH DEAD-box ATP-dependent RNA helicase 26	73.900%	Swiss-Prot	Low
`Q9FFQ1`	Arabidopsis thaliana	sp\|Q9FFQ1\|RH31_ARATH DEAD-box ATP-dependent RNA helicase 31	74.300%	Swiss-Prot	Low
`Q94C75`	Arabidopsis thaliana	sp\|Q94C75\|RH25_ARATH DEAD-box ATP-dependent RNA helicase 25	72.400%	Swiss-Prot	Low
`Q0DBU5`	Oryza sativa subsp. japonica	sp\|Q0DBU5\|RH31_ORYSJ DEAD-box ATP-dependent RNA helicase 31	73.000%	Swiss-Prot	Low
`Q5ZBH5`	Oryza sativa subsp. japonica	sp\|Q5ZBH5\|RH25_ORYSJ DEAD-box ATP-dependent RNA helicase 25	71.700%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card