TkAUNG081160 | RubberDandelionOmics

Gene overview

TkAUNG081160

Reference: TK1151 Chr: ChrUn Coordinates: 23127620-23128132 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

354 bp · TkAUNG081160|TK1151|cDNA

ATGATGGAGAAGAACACCACGAAAGCTAAAGGGGGGGATTCAATACGTTACATGCTTCTTCCATTCACTGTCCGTATGAGAGACGATCCATTGGACTACATTCGAGAAGCCAAGGCAGCGGTTGATACGAAGACAACCATCTATACCTTGTCGATTCTAGACTTGCTTCTTAAATTGTTGGGTATCAAGGCAGCAAGTTTTCTTTCTCACAAGATGTTCACAAATACAACATGGGTGGACCACTTGAAGAAAGCAGGTTT...

CDS

Download CDS FASTA

354 bp · TkAUNG081160|TK1151|CDS

ATGATGGAGAAGAACACCACGAAAGCTAAAGGGGGGGATTCAATACGTTACATGCTTCTTCCATTCACTGTCCGTATGAGAGACGATCCATTGGACTACATTCGAGAAGCCAAGGCAGCGGTTGATACGAAGACAACCATCTATACCTTGTCGATTCTAGACTTGCTTCTTAAATTGTTGGGTATCAAGGCAGCAAGTTTTCTTTCTCACAAGATGTTCACAAATACAACATGGGTGGACCACTTGAAGAAAGCAGGTTT...

Protein

Download Protein FASTA

117 aa · TkAUNG081160|TK1151|PROTEIN

MMEKNTTKAKGGDSIRYMLLPFTVRMRDDPLDYIREAKAAVDTKTTIYTLSILDLLLKLLGIKAASFLSHKMFTNTTWVDHLKKAGFIEFLATTSYGQPHGLTINFQSYMNKMTIVV

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkAUNG081160`
TK1151 ID	TkAUNG081160
OH-1004 ID	LXL04_026644
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	100.000
Protein coverage (%)	TK1151 72.650 / OH-1004 59.028 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkAUNG081160

Location ChrUn:23127620-23128132 (+)

Description Protein of unknown function

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g49190`	Bifunctional wax ester synthase/diacylglycerol acyltransferase (By similarity).	No verified direct reference in this release
`At5g53390`	Bifunctional wax ester synthase/diacylglycerol acyltransferase (By similarity).	Physical interaction of floral organs controls petal morphogenesis in Arabidopsis.2013 · DOI: 10.1104/pp.112.212084 The Half-Size ABC Transporter FOLDED PETALS 2/ABCG13 Is Involved in Petal Elongation through Narrow Spaces in Arabidopsis thaliana Floral Buds.2014 · DOI: 10.3390/plants3030348
`At3g49210`	Bifunctional wax ester synthase/diacylglycerol acyltransferase that uses acyl-CoAs with 16, 18 and 20 carbons as substrates, preferably in combination with 16:0ol alcohol.	Surface wax esters contribute to drought tolerance in Arabidopsis.2019 · DOI: 10.1111/tpj.14269

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_026644 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0009414 response to water deprivation Biological Process

GO:0009651 response to salt stress Biological Process

GO:0009737 response to abscisic acid Biological Process

GO:0019432 triglyceride biosynthetic process Biological Process

GO:0048441 petal development Biological Process

GO:0048446 petal morphogenesis Biological Process

GO:0005634 nucleus Cellular Component

GO:0005789 endoplasmic reticulum membrane Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0004144 diacylglycerol O-acyltransferase activity Molecular Function

GO:0008374 O-acyltransferase activity Molecular Function

GO:0047196 long-chain-alcohol O-fatty-acyltransferase activity Molecular Function

KEGG gene cross-reference

ag:AAZ08051

ath:AT2G38995

ath:AT3G49190

ath:AT3G49200

ath:AT5G53390

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Extracellular0.378

Rank 1 · TkAUNG081160 · TK1151

Endoplasmic reticulum0.369

Rank 2 · TkAUNG081160 · TK1151

Cytoplasm0.105

Rank 3 · TkAUNG081160 · TK1151

Cell membrane0.083

Rank 4 · TkAUNG081160 · TK1151

Lysosome / Vacuole0.077

Rank 5 · TkAUNG081160 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF06974WS_DGAT_C12-78 aa

PF06974WS_DGAT_C88-117 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkAUNG081160	`PF06974`	WS_DGAT_C	12	78	2.2e-15	57.7
TkAUNG081160	`PF06974`	WS_DGAT_C	88	117	2.2e-15	57.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9M3B3`	Arabidopsis thaliana	sp\|Q9M3B3\|WSD4_ARATH Wax ester synthase/diacylglycerol acyltransferase 4	37.700%	Swiss-Prot	Medium
`Q5KS41`	Arabidopsis thaliana	sp\|Q5KS41\|WSD11_ARATH Wax ester synthase/diacylglycerol acyltransferase 11	35.400%	Swiss-Prot	Medium
`Q9M3B1`	Arabidopsis thaliana	sp\|Q9M3B1\|WSD6_ARATH Wax ester synthase/diacylglycerol acyltransferase 6	34.400%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card