TkAUNG078510 | RubberDandelionOmics

Gene overview

TkAUNG078510

Reference: TK1151 Chr: ChrUn Coordinates: 22463669-22464028 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

360 bp · TkAUNG078510|TK1151|cDNA

ATGAATCTCAAGGGAAAACTCCTTAGGTCTCAAGAAAAATTGAAGTGGATTCGATCGCCGCCGCTTGTGATTGATCGGTTCATGGAGACAATCAATCAAAATAACGGTATCGTAGGTTCAATTGCAAGATCCGATTACTATGTTAGGATTCTTAATACTATTAATTGGGATCAATTGAACCCTTGGCATTCGTGGCTTTGCAACGTCATCCACAAGCGATTGTTGTGGTGCTGTCGCATGAGGCTGATTCTACTTAGCCA...

CDS

Download CDS FASTA

360 bp · TkAUNG078510|TK1151|CDS

ATGAATCTCAAGGGAAAACTCCTTAGGTCTCAAGAAAAATTGAAGTGGATTCGATCGCCGCCGCTTGTGATTGATCGGTTCATGGAGACAATCAATCAAAATAACGGTATCGTAGGTTCAATTGCAAGATCCGATTACTATGTTAGGATTCTTAATACTATTAATTGGGATCAATTGAACCCTTGGCATTCGTGGCTTTGCAACGTCATCCACAAGCGATTGTTGTGGTGCTGTCGCATGAGGCTGATTCTACTTAGCCA...

Protein

Download Protein FASTA

119 aa · TkAUNG078510|TK1151|PROTEIN

MNLKGKLLRSQEKLKWIRSPPLVIDRFMETINQNNGIVGSIARSDYYVRILNTINWDQLNPWHSWLCNVIHKRLLWCCRMRLILLSQSEKSNATYSVSFFDRITESISVLIGFSINYLF

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkAUNG078510`
TK1151 ID	TkAUNG078510
OH-1004 ID	LXL04_005550
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	98.000
Protein coverage (%)	TK1151 82.353 / OH-1004 63.226 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkAUNG078510

Location ChrUn:22463669-22464028 (+)

Description Similar to 26S proteasome regulatory subunit 6B homolog

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g58290`	The 26S proteasome is involved in the ATP-dependent degradation of ubiquitinated proteins.	A mutation in the Proteosomal Regulatory Particle AAA-ATPase-3 in Arabidopsis impairs the light-specific hypocotyl elongation response elicited by a glutamate receptor agonist, BMAA.2009 · DOI: 10.1007/s11103-009-9489-7

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_005550 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006511 ubiquitin-dependent protein catabolic process Biological Process

GO:0043161 proteasome-mediated ubiquitin-dependent protein catabolic process Biological Process

GO:0000502 proteasome complex Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0008540 proteasome regulatory particle, base subcomplex Cellular Component

GO:0009505 plant-type cell wall Cellular Component

GO:0009506 plasmodesma Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0005524 ATP binding Molecular Function

GO:0016887 ATP hydrolysis activity Molecular Function

GO:0036402 proteasome-activating activity Molecular Function

KEGG gene cross-reference

ath:AT5G58290

han:110873361

sot:102577768

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Mitochondrion0.513

Rank 1 · TkAUNG078510 · TK1151

Cytoplasm0.147

Rank 2 · TkAUNG078510 · TK1151

Nucleus0.133

Rank 3 · TkAUNG078510 · TK1151

Plastid0.111

Rank 4 · TkAUNG078510 · TK1151

Cell membrane0.041

Rank 5 · TkAUNG078510 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

No result was found for this query.

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SEI4`	Arabidopsis thaliana	sp\|Q9SEI4\|PRS6B_ARATH 26S proteasome regulatory subunit 6B homolog	49.000%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card