TkAUNG078100 | RubberDandelionOmics

Gene overview

TkAUNG078100

Reference: TK1151 Chr: ChrUn Coordinates: 22362245-22365054 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1326 bp · TkAUNG078100|TK1151|cDNA

AAAGAGGCCAAGATTTTAAATTAGTCTCCTCTCATCTTTCATAGAGAGAATTTTTGGGAGAAAGACATTGGAATAATGTTCTAAAGTCACGGTTATCTCAGTCCAGGTATCGTTTTATTCATCATTCCCGAAAAATTAAAGCGACTTAAAGATTTCAGTCACAATCAAGACTTCTTCTTCTTTCCATGTCAATGTCTTCTGAAATCTATGAATTTGATGGATGTCTTTTCAATGATCCATTTTCAACCATTGACATCCTC...

CDS

Download CDS FASTA

987 bp · TkAUNG078100|TK1151|CDS

ATGTCAATGTCTTCTGAAATCTATGAATTTGATGGATGTCTTTTCAATGATCCATTTTCAACCATTGACATCCTCCAAACTTTCCAAGAACACAATTACAACTACACCCCTTTACTACCATCGCCACCCTTGACCTTCAACCAAGAAAATCTTGACACCCCATTTGAAGAAATTGACCCAATTACCCCCACCATCATCCTCTCTTCCTCCCCACCATCCCACCAGCTTCAAAACCTCTCGCTTTATAACCAAATGGGTAT...

Protein

Download Protein FASTA

328 aa · TkAUNG078100|TK1151|PROTEIN

MSMSSEIYEFDGCLFNDPFSTIDILQTFQEHNYNYTPLLPSPPLTFNQENLDTPFEEIDPITPTIILSSSPPSHQLQNLSLYNQMGISVTSSNDVLDSCNLEVKTEESQLPLCDNYYYGGSDHAFKMMQRSYSSNSFQSQEKSNGVLYQPKFNGLIESANLHSQVVTSPDHSFSSTHMRRVCSTGDLQSPKVNQTSQRLSSSPLSTESSFMEEANFKVGRYNAEERKEKIMRYRAKRTQRNFNKTIKYACRKTLADNRPR...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkAUNG078100`
TK1151 ID	TkAUNG078100
OH-1004 ID	LXL04_005548
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkAUNG078100

Location ChrUn:22362245-22365054 (+)

Description Similar to COL4: Zinc finger protein CONSTANS-LIKE 4

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g24930`	Zinc finger protein CONSTANS-LIKE 4.	No verified direct reference in this release
`At5g57660`	Zinc finger protein CONSTANS-LIKE 5.	No verified direct reference in this release
`At2g24790`	Zinc finger protein CONSTANS-LIKE 3.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_005548 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0006355 regulation of DNA-templated transcription Biological Process

GO:0009658 chloroplast organization Biological Process

GO:0009908 flower development Biological Process

GO:0009909 regulation of flower development Biological Process

GO:0010099 regulation of photomorphogenesis Biological Process

GO:0010161 red light signaling pathway Biological Process

GO:0032922 circadian regulation of gene expression Biological Process

GO:0048577 negative regulation of short-day photoperiodism, flowering Biological Process

GO:2000028 regulation of photoperiodism, flowering Biological Process

GO:0005634 nucleus Cellular Component

GO:0016607 nuclear speck Cellular Component

KEGG gene cross-reference

ath:AT2G24790

ath:AT3G02380

ath:AT5G24930

ath:AT5G57660

dosa:Os09g0240200

osa:4346474

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.812

Rank 1 · TkAUNG078100 · TK1151

Cytoplasm0.323

Rank 2 · TkAUNG078100 · TK1151

Cell membrane0.037

Rank 3 · TkAUNG078100 · TK1151

Endoplasmic reticulum0.026

Rank 4 · TkAUNG078100 · TK1151

Mitochondrion0.020

Rank 5 · TkAUNG078100 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF06203CCT226-268 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkAUNG078100	`PF06203`	CCT	226	268	4.4e-19	69.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q940T9`	Arabidopsis thaliana	sp\|Q940T9\|COL4_ARATH Zinc finger protein CONSTANS-LIKE 4	48.400%	Swiss-Prot	Low
`Q9FHH8`	Arabidopsis thaliana	sp\|Q9FHH8\|COL5_ARATH Zinc finger protein CONSTANS-LIKE 5	50.000%	Swiss-Prot	Low
`Q9SK53`	Arabidopsis thaliana	sp\|Q9SK53\|COL3_ARATH Zinc finger protein CONSTANS-LIKE 3	45.200%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card