Gene Card
Gene overview
cDNA / CDS / Protein Sequences
2249 bp · TkAUNG072510|TK1151|cDNA
ATTTTTACTTTCAAGTTCCAAGTTATTAATTTAACATAAAAATCATTTAGTAAACTGTGTTTTTAAAGGGCTAAATACATTTTTTTGTCCCTGATAACTCTATGCAACAATGCCCTAACGATTAATTAATTTTGCTAAATAGGTGCATGAAATTCGTGACATTGGATGGGACGGAATCCCATCTCGAGGTGCTTCATGGTTGAGAGAATTACCACACGAGAACACGTGGATGCGGATAATCTTGATACCCACTTGTGGAG...
2142 bp · TkAUNG072510|TK1151|CDS
ATGCGGACTGTAAGGGCATGTGGATACGTTCCAATTGGTGGCCATCTTCTTCATCAAGCCTCCTATAACTATCACGGTACGTCATCATCACTCTCAACGCCACTCTTTCGCCTCGCCGTCACCGGTAGCTTCGACCGAAATCAGTACCATGCTTTATGTTCCCACCCCCGTCCTCTATCTATGTACTGGGTCGTTACAGCTGACAAACGTCAAAGCAGACAATTGGCTCGCGCTTCCAAGGATGATCAATTGGAGCGAGG...
Protein
Download Protein FASTA713 aa · TkAUNG072510|TK1151|PROTEIN
MRTVRACGYVPIGGHLLHQASYNYHGTSSSLSTPLFRLAVTGSFDRNQYHALCSHPRPLSMYWVVTADKRQSRQLARASKDDQLERGPKDLGNYEEDALLGGNSGIISACFVGLLTGLCVVLFNNAVHEIRDIGWDGIPSRGASWLRELPHENTWMRIILIPTCGGLIVSLLNIFRTALDEGNSGDNLKAVMKPILKAVAAAVTLGTGNSLGPEGPSVEIGASVAKGVGSLFDKNSQRKLSLKAAGSAAGISSGFNAAVA...
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | TkAUNG072510 |
|---|---|
| TK1151 ID | TkAUNG072510 |
| OH-1004 ID | LXL04_019546 |
| Relationship / confidence | Rbh Sequence Supported / Probable |
| Protein identity (%) | 99.000 |
| Protein coverage (%) | TK1151 100.000 / OH-1004 100.000Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | TK1151 / GWHBCHF00000000 |
SNP / Indel variants and carrier samplesCRA009020 · TK1151
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | TkAUNG072510 | |||||||||
|---|---|---|---|---|---|---|---|---|---|---|
| Location | ChrUn:20941432-20944659 (-) | |||||||||
| Description | Similar to CLC-E: Chloride channel protein CLC-e | |||||||||
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene Arabidopsis
RiceNo hit for this species in the current source table. | |||||||||
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · | |||||||||
| GO annotations (OH1004 source) | GO:0010027 thylakoid membrane organization Biological Process GO:0010447 response to acidic pH Biological Process GO:0042548 regulation of photosynthesis, light reaction Biological Process GO:1902476 chloride transmembrane transport Biological Process GO:0005794 Golgi apparatus Cellular Component GO:0005886 plasma membrane Cellular Component GO:0009507 chloroplast Cellular Component GO:0009535 chloroplast thylakoid membrane Cellular Component GO:0034707 chloride channel complex Cellular Component GO:0005247 voltage-gated chloride channel activity Molecular Function GO:0005254 chloride channel activity Molecular Function GO:0015297 antiporter activity Molecular Function | |||||||||
| KEGG gene cross-reference | ath:AT1G55620 ath:AT4G35440 rso:RSp0020 sec:SCH_0203 sei:SPC_0219 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF00654Voltage_CLC106-176 aaPF00654Voltage_CLC193-521 aaPF00571CBS563-615 aaPF00571CBS645-689 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| TkAUNG072510 | PF00654 | Voltage_CLC | 106 | 176 | 1.2e-73 | 249.0 |
| TkAUNG072510 | PF00654 | Voltage_CLC | 193 | 521 | 1.2e-73 | 249.0 |
| TkAUNG072510 | PF00571 | CBS | 563 | 615 | 7.5e-13 | 49.3 |
| TkAUNG072510 | PF00571 | CBS | 645 | 689 | 7.5e-13 | 49.3 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.