TkAUNG066530 | RubberDandelionOmics

Gene overview

TkAUNG066530

Reference: TK1151 Chr: ChrUn Coordinates: 19327386-19328569 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1080 bp · TkAUNG066530|TK1151|cDNA

TTTATAACATCACAAAACCCTCTTCTTAATATCTAATCTTATCTCACCTCAAAATATGTACTTTTTGCTACACCACACAAATCAAACAAAATCCCCCATTTTCCTTATTATATCCTACCATTATCGATCAAGGTTCAATATCAAGACTTAAAATCCGTAACCATCTTTGCATTTTTTGCTATTTCAGTCCTTTTGTCGGTCCAAGACTTGACGTCTCAACCTACGTACACACAGCTTCCTTTCAACAATATGGAAACACT...

CDS

Download CDS FASTA

747 bp · TkAUNG066530|TK1151|CDS

ATGGAAACACTAAATCTTGATTCATCATTACTTCCATATTTCACTCTCATGTATGTATCCATATATCTCATTGGCTACTCAACACTTTTCAAGAAATGGGATCCCAAGAAAAGGGTAGAGGCTTCAAGTTGTCTAATATCCTTAACTCATGGCACCCCAGCAGTCATCCTATCAATCTATGCAAATTTCCTACACCCACAAAAACCCGACCAAAACTTTGCTGCCCAAAACACACCATTTCAAGCCTTTGTTCTTGAATT...

Protein

Download Protein FASTA

248 aa · TkAUNG066530|TK1151|PROTEIN

METLNLDSSLLPYFTLMYVSIYLIGYSTLFKKWDPKKRVEASSCLISLTHGTPAVILSIYANFLHPQKPDQNFAAQNTPFQAFVLEFSIAYFFIDTSHYLIFIPNDYLLIAHHLAVLYVFITCRYVVGYGAYAILLLLALAEVTSFCQNIWSLARCRKDEATVAARLYVGLSPYFYGFYTVIRGLLGPLLMYKMVVFYLNGGGDGVVPMWAWGSWMVVIVNAILVSLLWVSNRWFELFKEKRKIRKSS

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkAUNG066530`
TK1151 ID	TkAUNG066530
OH-1004 ID	LXL04_006060
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	52.400
Protein coverage (%)	TK1151 90.726 / OH-1004 95.690 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkAUNG066530

Location ChrUn:19327386-19328569 (-)

Description Similar to At5g14285: TLC domain-containing protein At5g14285

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g14285`	TLC domain-containing protein At5g14285.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_006060 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0009507 chloroplast Cellular Component

GO:0016020 membrane Cellular Component

KEGG gene cross-reference

ath:AT5G14285

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Endoplasmic reticulum0.872

Rank 1 · TkAUNG066530 · TK1151

Nucleus0.082

Rank 2 · TkAUNG066530 · TK1151

Golgi apparatus0.067

Rank 3 · TkAUNG066530 · TK1151

Cytoplasm0.052

Rank 4 · TkAUNG066530 · TK1151

Cell membrane0.040

Rank 5 · TkAUNG066530 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF29060VTC5_C13-25 aa

PF22406DdMyo7_FERM16-101 aa

PF03798TRAM_LAG1_CLN817-27 aa

PF03798TRAM_LAG1_CLN842-231 aa

PF29060VTC5_C52-135 aa

PF28903GspL_M134-168 aa

PF28779Pro_C_rel212-241 aa

PF28903GspL_M212-243 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkAUNG066530	`PF29060`	VTC5_C	13	25	0.13	13.0
TkAUNG066530	`PF22406`	DdMyo7_FERM	16	101	0.22	12.7
TkAUNG066530	`PF03798`	TRAM_LAG1_CLN8	17	27	3.6e-15	57.1
TkAUNG066530	`PF03798`	TRAM_LAG1_CLN8	42	231	3.6e-15	57.1
TkAUNG066530	`PF29060`	VTC5_C	52	135	0.13	13.0
TkAUNG066530	`PF28903`	GspL_M	134	168	1.4	9.6
TkAUNG066530	`PF28779`	Pro_C_rel	212	241	0.084	13.8
TkAUNG066530	`PF28903`	GspL_M	212	243	1.4	9.6
TkAUNG066530	`PF29060`	VTC5_C	216	228	0.13	13.0
TkAUNG066530	`PF22406`	DdMyo7_FERM	219	237	0.22	12.7
TkAUNG066530	`PF28389`	VSTM5_C	220	245	0.00059	20.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8GYK7`	Arabidopsis thaliana	sp\|Q8GYK7\|Y5285_ARATH TLC domain-containing protein At5g14285	53.000%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card