TkAUNG066070 | RubberDandelionOmics

Gene overview

TkAUNG066070

Reference: TK1151 Chr: ChrUn Coordinates: 19202837-19203349 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

474 bp · TkAUNG066070|TK1151|cDNA

ATGTTGTCATATTATCTTAATGTTTCAACAGGCACCTATAAAGGCATTCTTTCTCTACAAAGAACAACTTTGGTTCGTCGTTCCAGTGAGAATTGGGGTCCTTCATGGAAGTTATTCAGTACCCCTCCACCACCTCCAGAGAAGACCCACTTTGGTGGCCTCAAAGATGAGGATCGCATCTTCACTAACGTATATGGCCTGCATGATCCCTTTCTGAAAGGTGCTATGAAACGTGGAGATTGGTACAGGACAAAAGACCT...

CDS

Download CDS FASTA

474 bp · TkAUNG066070|TK1151|CDS

ATGTTGTCATATTATCTTAATGTTTCAACAGGCACCTATAAAGGCATTCTTTCTCTACAAAGAACAACTTTGGTTCGTCGTTCCAGTGAGAATTGGGGTCCTTCATGGAAGTTATTCAGTACCCCTCCACCACCTCCAGAGAAGACCCACTTTGGTGGCCTCAAAGATGAGGATCGCATCTTCACTAACGTATATGGCCTGCATGATCCCTTTCTGAAAGGTGCTATGAAACGTGGAGATTGGTACAGGACAAAAGACCT...

Protein

Download Protein FASTA

157 aa · TkAUNG066070|TK1151|PROTEIN

MLSYYLNVSTGTYKGILSLQRTTLVRRSSENWGPSWKLFSTPPPPPEKTHFGGLKDEDRIFTNVYGLHDPFLKGAMKRGDWYRTKDLVLKGSDWIVNEMKKSGLRGRGGAGFPSGLKWSFMPKTSDGRPSYLVVNADESEPGTCKDREIMRHDPHNY

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkAUNG066070`
TK1151 ID	TkAUNG066070
OH-1004 ID	LXL04_023922
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	73.600
Protein coverage (%)	TK1151 89.172 / OH-1004 29.787 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkAUNG066070

Location ChrUn:19202837-19203349 (-)

Description Similar to At5g08530: NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g08530`	Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_023922 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006120 mitochondrial electron transport, NADH to ubiquinone Biological Process

GO:0009060 aerobic respiration Biological Process

GO:0022904 respiratory electron transport chain Biological Process

GO:0042775 mitochondrial ATP synthesis coupled electron transport Biological Process

GO:0042776 proton motive force-driven mitochondrial ATP synthesis Biological Process

GO:0005739 mitochondrion Cellular Component

GO:0005743 mitochondrial inner membrane Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0031966 mitochondrial membrane Cellular Component

GO:0045271 respiratory chain complex I Cellular Component

GO:0008137 NADH dehydrogenase (ubiquinone) activity Molecular Function

GO:0010181 FMN binding Molecular Function

KEGG gene cross-reference

ath:AT5G08530

ddi:DDB_G0288875

hsa:4723

mmu:17995

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Mitochondrion0.920

Rank 1 · TkAUNG066070 · TK1151

Cytoplasm0.070

Rank 2 · TkAUNG066070 · TK1151

Nucleus0.065

Rank 3 · TkAUNG066070 · TK1151

Cell membrane0.024

Rank 4 · TkAUNG066070 · TK1151

Plastid0.019

Rank 5 · TkAUNG066070 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01512Complex1_51K99-156 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkAUNG066070	`PF01512`	Complex1_51K	99	156	1e-19	71.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FNN5`	Arabidopsis thaliana	sp\|Q9FNN5\|NDUV1_ARATH NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial	74.800%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card