TkAUNG066000 | RubberDandelionOmics

Gene overview

TkAUNG066000

Reference: TK1151 Chr: ChrUn Coordinates: 19183762-19185079 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

729 bp · TkAUNG066000|TK1151|cDNA

ATGTGGCTTCCCATTGCAAAAGTCTTGCAAGAACACTTCAGATACTTCACCTGTGTTGAGTATGGCCCACAGGATAACAATGGGGTTAGTGAGCGAAAAGGGCTGAAGCCGGGCCTGATCATACTGATCTCGGTGGCTGATGCGATAGCAGTGGCGTTCGTAGGGTTAGTCATCGTTTATGTCTATTGGAAGAGAAAGGATTCTCATGGATGTAGTTGTACTGGGAAGGGGAAGCTTGGAGGCAATGAGAAAACAGGGCT...

CDS

Download CDS FASTA

729 bp · TkAUNG066000|TK1151|CDS

ATGTGGCTTCCCATTGCAAAAGTCTTGCAAGAACACTTCAGATACTTCACCTGTGTTGAGTATGGCCCACAGGATAACAATGGGGTTAGTGAGCGAAAAGGGCTGAAGCCGGGCCTGATCATACTGATCTCGGTGGCTGATGCGATAGCAGTGGCGTTCGTAGGGTTAGTCATCGTTTATGTCTATTGGAAGAGAAAGGATTCTCATGGATGTAGTTGTACTGGGAAGGGGAAGCTTGGAGGCAATGAGAAAACAGGGCT...

Protein

Download Protein FASTA

242 aa · TkAUNG066000|TK1151|PROTEIN

MWLPIAKVLQEHFRYFTCVEYGPQDNNGVSERKGLKPGLIILISVADAIAVAFVGLVIVYVYWKRKDSHGCSCTGKGKLGGNEKTGLCVFPCITGFPSNDSEVESEKGGGSGGAAGGMSGGEGDLVAIDKGFNFELDELLRASAYVLGKSGLGIVYKVVLGNGVPVAVRRLGEGGEQRYKEFVSEVQAIGRIKHPNVVKLRAYYWAPDEKLSLAISFPMGTWLLLFVVKQGSNHPPYHGQSD

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkAUNG066000`
TK1151 ID	TkAUNG066000
OH-1004 ID	LXL04_020663
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	78.900
Protein coverage (%)	TK1151 77.686 / OH-1004 25.232 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkAUNG066000

Location ChrUn:19183762-19185079 (-)

Description Similar to ZAR1: Receptor protein kinase-like protein ZAR1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g01210`	Receptor protein kinase acting as an integrator for intracellular calcium and heterotrimeric G protein signaling with extracellular signals during early zygote development.	No verified direct reference in this release
`At4g34220`	Receptor protein kinase-like protein At4g34220.	No verified direct reference in this release
`At1g66830`	Probable inactive leucine-rich repeat receptor-like protein kinase At1g66830.	No verified direct reference in this release
`At4g37250`	Probable LRR receptor-like serine/threonine-protein kinase At4g37250.	No verified direct reference in this release
`At1g68400`	Probable leucine-rich repeat receptor-like protein kinase At1g68400.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_020663 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0009789 positive regulation of abscisic acid-activated signaling pathway Biological Process

GO:0010030 positive regulation of seed germination Biological Process

GO:0010069 zygote asymmetric cytokinesis in embryo sac Biological Process

GO:0010070 zygote asymmetric cell division Biological Process

GO:0042631 cellular response to water deprivation Biological Process

GO:0046777 protein autophosphorylation Biological Process

GO:0062207 regulation of pattern recognition receptor signaling pathway Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009505 plant-type cell wall Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0009570 chloroplast stroma Cellular Component

KEGG gene cross-reference

ath:AT1G66830

ath:AT2G01210

ath:AT3G56100

ath:AT4G34220

ath:AT4G37250

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.690

Rank 1 · TkAUNG066000 · TK1151

Endoplasmic reticulum0.128

Rank 2 · TkAUNG066000 · TK1151

Cytoplasm0.091

Rank 3 · TkAUNG066000 · TK1151

Nucleus0.067

Rank 4 · TkAUNG066000 · TK1151

Lysosome / Vacuole0.063

Rank 5 · TkAUNG066000 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF04689S1FA31-64 aa

PF00420Oxidored_q235-68 aa

PF12669FeoB_associated48-74 aa

PF07714PK_Tyr_Ser-Thr146-223 aa

PF00069Pkinase146-220 aa

PF04689S1FA219-228 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkAUNG066000	`PF04689`	S1FA	31	64	1.9e-05	25.4
TkAUNG066000	`PF00420`	Oxidored_q2	35	68	0.087	13.3
TkAUNG066000	`PF12669`	FeoB_associated	48	74	0.0071	17.4
TkAUNG066000	`PF07714`	PK_Tyr_Ser-Thr	146	223	0.00041	20.5
TkAUNG066000	`PF00069`	Pkinase	146	220	0.00054	20.2
TkAUNG066000	`PF04689`	S1FA	219	228	1.9e-05	25.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9ZU46`	Arabidopsis thaliana	sp\|Q9ZU46\|ZAR1_ARATH Receptor protein kinase-like protein ZAR1	43.800%	Swiss-Prot	Medium
`Q94C77`	Arabidopsis thaliana	sp\|Q94C77\|RPKL_ARATH Receptor protein kinase-like protein At4g34220	34.500%	Swiss-Prot	Medium
`Q9C9N5`	Arabidopsis thaliana	sp\|Q9C9N5\|Y1668_ARATH Probable inactive leucine-rich repeat receptor-like protein kinase At1g66830	35.400%	Swiss-Prot	Medium
`C0LGS3`	Arabidopsis thaliana	sp\|C0LGS3\|Y4372_ARATH Probable LRR receptor-like serine/threonine-protein kinase At4g37250	31.700%	Swiss-Prot	Medium
`Q9M9C5`	Arabidopsis thaliana	sp\|Q9M9C5\|Y1680_ARATH Probable leucine-rich repeat receptor-like protein kinase At1g68400	33.000%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card