TkAUNG065800 | RubberDandelionOmics

Gene overview

TkAUNG065800

Reference: TK1151 Chr: ChrUn Coordinates: 19091726-19092061 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

336 bp · TkAUNG065800|TK1151|cDNA

ATGGGTGCAGCTGATTCCTCTTCCACTTCACCAATCTTCGCCCTCAGAAACTCGCGGTTTCCGGACGATATCGTTTTCTACTCCATCTTCCCTCACTCCTGCGTCACCTCCACCGCCGCCGCCGTTTCCGACGAATTGCAGTCGCTCCATCTCCAAGTCTTCGACCACATCGCTCAGTTCGCTGGAGCATACATCTGGCAACACCAACCCTTTCTCTCTCTCCATAACTCTCTCGCCTATTCCTCATCCCTCCGGCCACC...

CDS

Download CDS FASTA

336 bp · TkAUNG065800|TK1151|CDS

ATGGGTGCAGCTGATTCCTCTTCCACTTCACCAATCTTCGCCCTCAGAAACTCGCGGTTTCCGGACGATATCGTTTTCTACTCCATCTTCCCTCACTCCTGCGTCACCTCCACCGCCGCCGCCGTTTCCGACGAATTGCAGTCGCTCCATCTCCAAGTCTTCGACCACATCGCTCAGTTCGCTGGAGCATACATCTGGCAACACCAACCCTTTCTCTCTCTCCATAACTCTCTCGCCTATTCCTCATCCCTCCGGCCACC...

Protein

Download Protein FASTA

111 aa · TkAUNG065800|TK1151|PROTEIN

MGAADSSSTSPIFALRNSRFPDDIVFYSIFPHSCVTSTAAAVSDELQSLHLQVFDHIAQFAGAYIWQHQPFLSLHNSLAYSSSLRPPPFRRQSRRRVVRRLPSLRNIEKLP

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkAUNG065800`
TK1151 ID	TkAUNG065800
OH-1004 ID	LXL04_014011
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	38.300
Protein coverage (%)	TK1151 70.270 / OH-1004 12.841 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkAUNG065800`
Location	ChrUn:19091726-19092061 (-)
Description	Similar to At5g65490: Protein ecdysoneless homolog
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_014011` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0000398 mRNA splicing, via spliceosome Biological Process GO:0006351 DNA-templated transcription Biological Process GO:0006397 mRNA processing Biological Process GO:0007030 Golgi organization Biological Process GO:0007281 germ cell development Biological Process GO:0008283 cell population proliferation Biological Process GO:0008380 RNA splicing Biological Process GO:0009608 response to symbiont Biological Process GO:0045944 positive regulation of transcription by RNA polymerase II Biological Process GO:2000045 regulation of G1/S transition of mitotic cell cycle Biological Process GO:0005634 nucleus Cellular Component GO:0005654 nucleoplasm Cellular Component
KEGG gene cross-reference	ath:AT5G65490 ddi:DDB_G0287829 dme:Dmel_CG5714 hsa:11319 mmu:70601 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.517

Rank 1 · TkAUNG065800 · TK1151

Cytoplasm0.397

Rank 2 · TkAUNG065800 · TK1151

Cell membrane0.085

Rank 3 · TkAUNG065800 · TK1151

Endoplasmic reticulum0.081

Rank 4 · TkAUNG065800 · TK1151

Mitochondrion0.068

Rank 5 · TkAUNG065800 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF07093SGT125-71 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkAUNG065800	`PF07093`	SGT1	25	71	5.6e-07	29.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card