TkAUNG061200 | RubberDandelionOmics

Gene overview

TkAUNG061200

Reference: TK1151 Chr: ChrUn Coordinates: 17805460-17806071 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

306 bp · TkAUNG061200|TK1151|cDNA

ATGAAAGAGATTGCTTTTAAGAGGCAAACTGAACTTGAGGAGATATTTGCTCATGCTCATGTAGAGACTGATCCTGATGCTGCTCGAGAAAAATTTCTGTCTCTTATTGATTCGGGGAGTGTTGAGCCTGCAGAGTTATTGGCTGACATGGATAATCAGATAATAAAAGCAAAGGAAGAGGCTGCTAGTAGGAAGGATATATTGGACAAGGTTGAGAAATGGATGTCAGCTTGTGAGAAGAAAGCTGGCTTGAAGACTAC...

CDS

Download CDS FASTA

306 bp · TkAUNG061200|TK1151|CDS

ATGAAAGAGATTGCTTTTAAGAGGCAAACTGAACTTGAGGAGATATTTGCTCATGCTCATGTAGAGACTGATCCTGATGCTGCTCGAGAAAAATTTCTGTCTCTTATTGATTCGGGGAGTGTTGAGCCTGCAGAGTTATTGGCTGACATGGATAATCAGATAATAAAAGCAAAGGAAGAGGCTGCTAGTAGGAAGGATATATTGGACAAGGTTGAGAAATGGATGTCAGCTTGTGAGAAGAAAGCTGGCTTGAAGACTAC...

Protein

Download Protein FASTA

101 aa · TkAUNG061200|TK1151|PROTEIN

MKEIAFKRQTELEEIFAHAHVETDPDAAREKFLSLIDSGSVEPAELLADMDNQIIKAKEEAASRKDILDKVEKWMSACEKKAGLKTTTEMKTGTMRVEVHI

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkAUNG061200`
TK1151 ID	TkAUNG061200
OH-1004 ID	LXL04_031009
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	82.100
Protein coverage (%)	TK1151 83.168 / OH-1004 7.083 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkAUNG061200

Location ChrUn:17805460-17806071 (-)

Description Similar to MAP65-1: 65-kDa microtubule-associated protein 1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g55230`	Microtubule-associated protein that bundle and stabilize adjacent microtubules (MT) of the cell cortex.	In vivo dynamics and differential microtubule-binding activities of MAP65 proteins.2004 · DOI: 10.1104/pp.104.051623 Two microtubule-associated proteins of the Arabidopsis MAP65 family function differently on microtubules.2005 · DOI: 10.1104/pp.104.052456 Dynamic interaction of NtMAP65-1a with microtubules in vivo.2005 · DOI: 10.1242/jcs.02433 Modulated targeting of GFP-AtMAP65-1 to central spindle microtubules during division.2005 · DOI: 10.1111/j.1365-313x.2005.02464.x Control of the AtMAP65-1 interaction with microtubules through the cell cycle.2006 · DOI: 10.1242/jcs.03051 AtMAP65-1 binds to tubulin dimers to promote tubulin assembly.2007 · DOI: 10.5483/bmbrep.2007.40.2.218 Two microtubule-associated proteins of Arabidopsis MAP65s promote antiparallel microtubule bundling.2008 · DOI: 10.1091/mbc.e08-04-0341 Arabidopsis homologs of nucleus- and phragmoplast-localized kinase 2 and 3 and mitogen-activated protein kinase 4 are essential for microtubule organization.2010 · DOI: 10.1105/tpc.109.071746
`At4g26760`	Microtubule-associated protein that stabilize microtubules (MT).	Arabidopsis microtubule-associated protein AtMAP65-2 acts as a microtubule stabilizer.2009 · DOI: 10.1007/s11103-008-9426-1
`At2g01910`	Microtubule-associated protein that mediates the formation of a mesh-like stable and dense network formed by individual microtubules (MT).	Two microtubule-associated proteins of the Arabidopsis MAP65 family function differently on microtubules.2005 · DOI: 10.1104/pp.104.052456
`At1g14690`	65-kDa microtubule-associated protein 7.	No verified direct reference in this release
`At2g38720`	Microtubule-associated protein that bundle and stabilize adjacent microtubules (MT) of the cell cortex.	In vivo dynamics and differential microtubule-binding activities of MAP65 proteins.2004 · DOI: 10.1104/pp.104.051623 Two microtubule-associated proteins of Arabidopsis MAP65s promote antiparallel microtubule bundling.2008 · DOI: 10.1091/mbc.e08-04-0341

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_031009 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0000226 microtubule cytoskeleton organization Biological Process

GO:0000911 cytokinesis by cell plate formation Biological Process

GO:0001578 microtubule bundle formation Biological Process

GO:0007020 microtubule nucleation Biological Process

GO:0031116 positive regulation of microtubule polymerization Biological Process

GO:0043622 cortical microtubule organization Biological Process

GO:0046785 microtubule polymerization Biological Process

GO:0048528 post-embryonic root development Biological Process

GO:0051301 cell division Biological Process

GO:0000922 spindle pole Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

KEGG gene cross-reference

ath:AT1G14690

ath:AT4G26760

ath:AT5G55230

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.511

Rank 1 · TkAUNG061200 · TK1151

Nucleus0.478

Rank 2 · TkAUNG061200 · TK1151

Mitochondrion0.054

Rank 3 · TkAUNG061200 · TK1151

Cell membrane0.042

Rank 4 · TkAUNG061200 · TK1151

Extracellular0.041

Rank 5 · TkAUNG061200 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF03999MAP65_ASE11-83 aa

PF22638FlgK_D145-99 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkAUNG061200	`PF03999`	MAP65_ASE1	1	83	1.6e-05	24.6
TkAUNG061200	`PF22638`	FlgK_D1	45	99	0.13	12.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FLP0`	Arabidopsis thaliana	sp\|Q9FLP0\|MA651_ARATH 65-kDa microtubule-associated protein 1	75.000%	Swiss-Prot	High
`Q8LEG3`	Arabidopsis thaliana	sp\|Q8LEG3\|MA652_ARATH 65-kDa microtubule-associated protein 2	69.000%	Swiss-Prot	High
`Q9SIS3`	Arabidopsis thaliana	sp\|Q9SIS3\|MA656_ARATH 65-kDa microtubule-associated protein 6	50.600%	Swiss-Prot	High
`Q8L836`	Arabidopsis thaliana	sp\|Q8L836\|MA657_ARATH 65-kDa microtubule-associated protein 7	46.700%	Swiss-Prot	Medium
`Q9ZVJ3`	Arabidopsis thaliana	sp\|Q9ZVJ3\|MA655_ARATH 65-kDa microtubule-associated protein 5	52.400%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card