TkAUNG059730 | RubberDandelionOmics

Gene overview

TkAUNG059730

Reference: TK1151 Chr: ChrUn Coordinates: 17414444-17419760 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

911 bp · TkAUNG059730|TK1151|cDNA

ATAAAAAATAAATTTTAAATATTTATTCAGGAGACTATTTGGTTTTTTTTGGATAATACTTTTATCTAAAAAGGACTTGTCAATCTTAGAAAACTTGGCCACACCTTATCCGCAAACACTAGTGATTCTAAGAACAACACCACCTTCCATTTTCATGACCAAAAACAAAACCCTAACTTCATCCAACTTACTTCAAAAAATATCACAAAATGTCGGTGGCTTCAATCCAATGCATCCGACTATCAAATTCATCATCAAAC...

CDS

Download CDS FASTA

396 bp · TkAUNG059730|TK1151|CDS

ATGTCGGTGGCTTCAATCCAATGCATCCGACTATCAAATTCATCATCAAACGCACCTGCTTTTAGATTCTCTGCAACCAAGCCTACGATATTTACCATACGCAGCGCTCAATCCGATGGCCCTTTGCGAAGACCTTCCATCGCTACTCCGCCTGTAAGACCTTCCATTCCTCCGTCGCCGTCTCCTAATTCACCAACGCCTCCGTCAGCTCCGGCGAAGCCGGTGGCGGAAACAACGGCGGCTGGTCAGAATGTTATAAC...

Protein

Download Protein FASTA

131 aa · TkAUNG059730|TK1151|PROTEIN

MSVASIQCIRLSNSSSNAPAFRFSATKPTIFTIRSAQSDGPLRRPSIATPPVRPSIPPSPSPNSPTPPSAPAKPVAETTAAGQNVITMEYQRQRAKELQEYFKQKKIEEANQGPFFGFIAKNEISNGSFMY

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkAUNG059730`
TK1151 ID	TkAUNG059730
OH-1004 ID	LXL04_035884
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	100.000
Protein coverage (%)	TK1151 96.947 / OH-1004 76.970 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkAUNG059730

Location ChrUn:17414444-17419760 (+)

Description Similar to OHP2: Light-harvesting complex-like protein OHP2, chloroplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g34000`	May play a photoprotective role within PSI in response to light stress.	Light stress-induced one-helix protein of the chlorophyll a/b-binding family associated with photosystem I.2003 · DOI: 10.1104/pp.102.019281 ONE-HELIX PROTEIN2 (OHP2) Is Required for the Stability of OHP1 and Assembly Factor HCF244 and Is Functionally Linked to PSII Biogenesis.2018 · DOI: 10.1104/pp.18.00540 OHP1, OHP2, and HCF244 Form a Transient Functional Complex with the Photosystem II Reaction Center.2019 · DOI: 10.1104/pp.18.01231 Exploring the Link between Photosystem II Assembly and Translation of the Chloroplast psbA mRNA.2020 · DOI: 10.3390/plants9020152 ONE-HELIX PROTEIN1 and 2 Form Heterodimers to Bind Chlorophyll in Photosystem II Biogenesis.2020 · DOI: 10.1104/pp.19.01304

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_035884 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0009642 response to light intensity Biological Process

GO:0010207 photosystem II assembly Biological Process

GO:0005634 nucleus Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0009534 chloroplast thylakoid Cellular Component

GO:0009535 chloroplast thylakoid membrane Cellular Component

KEGG gene cross-reference

ath:AT1G34000

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.981

Rank 1 · TkAUNG059730 · TK1151

Mitochondrion0.022

Rank 2 · TkAUNG059730 · TK1151

Nucleus0.020

Rank 3 · TkAUNG059730 · TK1151

Cytoplasm0.014

Rank 4 · TkAUNG059730 · TK1151

Cell membrane0.008

Rank 5 · TkAUNG059730 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF05308Mito_fiss_reg35-105 aa

PF01094ANF_receptor75-111 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkAUNG059730	`PF05308`	Mito_fiss_reg	35	105	1.3	9.8
TkAUNG059730	`PF01094`	ANF_receptor	75	111	0.27	11.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FEC1`	Arabidopsis thaliana	sp\|Q9FEC1\|OHP2_ARATH Light-harvesting complex-like protein OHP2, chloroplastic	60.000%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card