TkAUNG058070 | RubberDandelionOmics

Gene overview

TkAUNG058070

Reference: TK1151 Chr: ChrUn Coordinates: 16964404-16965188 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

605 bp · TkAUNG058070|TK1151|cDNA

TTACAGGTTAGGGCTTCACTTGAGGAACATTTTGGTCAATGTGGAGAGATTGCACGCTGTTCCATTCCAAAAGATTACGAATCTGGCGGTCCTAAAGGGGTTGCATTTATCGACTTCAATGATAGTGCTGCATTGAACAAAGCTTTGGAACTGAGTGGTACTGAAGTTGCAGGCGGTACACTTACTGTTGAGGAAGCTAAGCCAAGAGGTGATAGTGGTGGATTCAGTGGCGGACGTGGTGGAGGACGTGGATTTGATGG...

CDS

Download CDS FASTA

456 bp · TkAUNG058070|TK1151|CDS

TTACAGGTTAGGGCTTCACTTGAGGAACATTTTGGTCAATGTGGAGAGATTGCACGCTGTTCCATTCCAAAAGATTACGAATCTGGCGGTCCTAAAGGGGTTGCATTTATCGACTTCAATGATAGTGCTGCATTGAACAAAGCTTTGGAACTGAGTGGTACTGAAGTTGCAGGCGGTACACTTACTGTTGAGGAAGCTAAGCCAAGAGGTGATAGTGGTGGATTCAGTGGCGGACGTGGTGGAGGACGTGGATTTGATGG...

Protein

Download Protein FASTA

151 aa · TkAUNG058070|TK1151|PROTEIN

LQVRASLEEHFGQCGEIARCSIPKDYESGGPKGVAFIDFNDSAALNKALELSGTEVAGGTLTVEEAKPRGDSGGFSGGRGGGRGFDGGRSGGRGGRGGRFGGRDGGGFSGGRGGRFSGGRDGGRGGRGGRGPNRPSMATPGTGKKTTFGDE

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkAUNG058070`
TK1151 ID	TkAUNG058070
OH-1004 ID	LXL04_000987
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	100.000
Protein coverage (%)	TK1151 98.675 / OH-1004 35.646 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkAUNG058070

Location ChrUn:16964404-16965188 (-)

Description Similar to PHOT1: Phototropin-1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g18610`	Involved in pre-rRNA processing and ribosome assembly.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os04g0620700`	Involved in pre-rRNA processing and ribosome assembly.	No verified direct reference in this release
`Os08g0192900`	Involved in pre-rRNA processing and ribosome assembly.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_000987 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006364 rRNA processing Biological Process

GO:0007623 circadian rhythm Biological Process

GO:0009637 response to blue light Biological Process

GO:0009638 phototropism Biological Process

GO:0009639 response to red or far red light Biological Process

GO:0009785 blue light signaling pathway Biological Process

GO:0009903 chloroplast avoidance movement Biological Process

GO:0009904 chloroplast accumulation movement Biological Process

GO:0010119 regulation of stomatal movement Biological Process

GO:0010155 regulation of proton transport Biological Process

GO:0046777 protein autophosphorylation Biological Process

GO:0060772 leaf phyllotactic patterning Biological Process

KEGG gene cross-reference

ath:AT3G18610

ath:AT3G45780

dosa:Os04g0620700

dosa:Os11g0102200

dosa:Os12g0101800

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.787

Rank 1 · TkAUNG058070 · TK1151

Cytoplasm0.540

Rank 2 · TkAUNG058070 · TK1151

Extracellular0.100

Rank 3 · TkAUNG058070 · TK1151

Endoplasmic reticulum0.047

Rank 4 · TkAUNG058070 · TK1151

Cell membrane0.040

Rank 5 · TkAUNG058070 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00076RRM_16-61 aa

PF14605Nup35_RRM_29-49 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkAUNG058070	`PF00076`	RRM_1	6	61	1.2e-11	45.1
TkAUNG058070	`PF14605`	Nup35_RRM_2	9	49	0.29	11.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q1PEP5`	Arabidopsis thaliana	sp\|Q1PEP5\|NUCL2_ARATH Nucleolin 2	39.700%	Swiss-Prot	Medium
`Q7XTT4`	Oryza sativa subsp. japonica	sp\|Q7XTT4\|NUCL2_ORYSJ Nucleolin 2	60.500%	Swiss-Prot	Medium
`Q6Z1C0`	Oryza sativa subsp. japonica	sp\|Q6Z1C0\|NUCL1_ORYSJ Nucleolin 1	56.800%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card