Gene Card
Gene overview
cDNA / CDS / Protein Sequences
576 bp · TkAUNG057250|TK1151|cDNA
ATGAATATATTTTTCTTGGGTGTAGCATTGCAGCAAATCAACGTTTTTTTTTTTTTTCTTTTGCAGTTGCTTTATAGGAGGTACAGTGGAAATTTCCTTGTGAATCTTTTGGGGAAGTGGAAGGAATCTGAGTATTCTGGTCAATCTGTTCCCGTTGGTGGTCTTGCTTACTACATTACTGCACCATCAAGTTTGTCGGATATAGTGGCCAATCCTTTCCATGGACTATTCTATATTGTATTTATGCTGTCAGCTTGTGC...
576 bp · TkAUNG057250|TK1151|CDS
ATGAATATATTTTTCTTGGGTGTAGCATTGCAGCAAATCAACGTTTTTTTTTTTTTTCTTTTGCAGTTGCTTTATAGGAGGTACAGTGGAAATTTCCTTGTGAATCTTTTGGGGAAGTGGAAGGAATCTGAGTATTCTGGTCAATCTGTTCCCGTTGGTGGTCTTGCTTACTACATTACTGCACCATCAAGTTTGTCGGATATAGTGGCCAATCCTTTCCATGGACTATTCTATATTGTATTTATGCTGTCAGCTTGTGC...
Protein
Download Protein FASTA191 aa · TkAUNG057250|TK1151|PROTEIN
MNIFFLGVALQQINVFFFFLLQLLYRRYSGNFLVNLLGKWKESEYSGQSVPVGGLAYYITAPSSLSDIVANPFHGLFYIVFMLSACALFSKTWIEVSGSSAKDVAKQLKEQQMVMPGHRESNLQKELNRYIPTAAAFGGMCIGALTVLADLMGAIGSGTGILLAVTIIYQYFETFEKEKASELGFFGSKIT
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | TkAUNG057250 |
|---|---|
| TK1151 ID | TkAUNG057250 |
| OH-1004 ID | LXL04_010362 |
| Relationship / confidence | Non Reciprocal Best Hit / Complex relationship |
| Protein identity (%) | 90.600 |
| Protein coverage (%) | TK1151 89.005 / OH-1004 35.789Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | TK1151 / GWHBCHF00000000 |
SNP / Indel variants and carrier samplesCRA009020 · TK1151
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | TkAUNG057250 |
|---|---|
| Location | ChrUn:16368446-16369466 (-) |
| Description | Similar to sec61a: Protein transport protein Sec61 subunit alpha |
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene ArabidopsisNo hit for this species in the current source table. RiceNo hit for this species in the current source table. |
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · |
| GO annotations (OH1004 source) | GO:0006616 SRP-dependent cotranslational protein targeting to membrane, translocation Biological Process GO:0015031 protein transport Biological Process GO:0031204 post-translational protein targeting to membrane, translocation Biological Process GO:0005783 endoplasmic reticulum Cellular Component GO:0005784 Sec61 translocon complex Cellular Component GO:0005789 endoplasmic reticulum membrane Cellular Component GO:0005048 signal sequence binding Molecular Function GO:0008320 protein transmembrane transporter activity Molecular Function GO:0015450 protein-transporting ATPase activity Molecular Function GO:0043022 ribosome binding Molecular Function |
| KEGG gene cross-reference | bta:614128 ddi:DDB_G0278885 hsa:55176 mmu:57743 pon:100174115 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF00344SecY60-172 aaPF253236TM_PilS75-91 aaPF253236TM_PilS122-168 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| TkAUNG057250 | PF00344 | SecY | 60 | 172 | 2.3e-26 | 93.6 |
| TkAUNG057250 | PF25323 | 6TM_PilS | 75 | 91 | 0.13 | 12.7 |
| TkAUNG057250 | PF25323 | 6TM_PilS | 122 | 168 | 0.13 | 12.7 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.
No result was found for this query.