TkAUNG053040 | RubberDandelionOmics

Gene overview

TkAUNG053040

Reference: TK1151 Chr: ChrUn Coordinates: 15146823-15150086 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2252 bp · TkAUNG053040|TK1151|cDNA

GTCACACCCTTAATGTACAACTTGTGATGAACAAGGTACAGATTTTGTCAGCAAGAGGGCAAATTGCAAGACCCTAGGCATTGTCAACTACCCTTTGCTAGTAAAAGTCTCCAAATCGACCACGAAACTACACCATTCGCATCTCCATCGTTTTTCCCGTCAAAATTCTCGATTTCCCCTTCCATCAAATCTCTCTACAATCCAGTCAAGACAATGGAGTTCGAATCCAACAACATTGCTGAAGAAAGCAACAACAATCA...

CDS

Download CDS FASTA

1761 bp · TkAUNG053040|TK1151|CDS

ATGGAGTTCGAATCCAACAACATTGCTGAAGAAAGCAACAACAATCACGGATGGCAAAAGGTTACTTACCCTAAGAAGCAGAGGAAGAATCCGGCGAAGCAGCAACAGCAGCAGCCGACGAAGGTGTCTTCTAACGGATCTTCCATCTCGGCCGTCGATAATGTATTCACATCCATTGAGAAGAAATCGGAGGAGCGTAGGAAGCTTATTGAAGCTGAGAGATTAGCGAATTCGGCGATGTATGATCCTGCTCCGCCGAC...

Protein

Download Protein FASTA

586 aa · TkAUNG053040|TK1151|PROTEIN

MEFESNNIAEESNNNHGWQKVTYPKKQRKNPAKQQQQQPTKVSSNGSSISAVDNVFTSIEKKSEERRKLIEAERLANSAMYDPAPPTRSSKKNNYSDYDDSDEEDVANGVADNGVAEEKKTKPKKVKKPKVTVPEAAAKIDAAELASFLSDVTASFETQQDIQMMRFADYFGRAFASVSASQFPWVKLLRESAVAKVADNPVSHIPEAVYKTSVDWINNRSLEALGSFVLWSLDSIIADFASQQGNAKGSKKVAQKPSSK...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkAUNG053040`
TK1151 ID	TkAUNG053040
OH-1004 ID	LXL04_021214
Relationship / confidence	Rbh Sequence Supported / Probable
Protein identity (%)	99.800
Protein coverage (%)	TK1151 100.000 / OH-1004 85.777 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkAUNG053040`
Location	ChrUn:15146823-15150086 (+)
Description	Similar to tmem214-a: Transmembrane protein 214-A
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_021214` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0005783 endoplasmic reticulum Cellular Component GO:0005789 endoplasmic reticulum membrane Cellular Component GO:0005794 Golgi apparatus Cellular Component GO:0005829 cytosol Cellular Component GO:0005881 cytoplasmic microtubule Cellular Component
KEGG gene cross-reference	bta:514683 mmu:68796 rno:362711 xla:100036861 xla:779351 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.370

Rank 1 · TkAUNG053040 · TK1151

Cytoplasm0.309

Rank 2 · TkAUNG053040 · TK1151

Endoplasmic reticulum0.165

Rank 3 · TkAUNG053040 · TK1151

Cell membrane0.153

Rank 4 · TkAUNG053040 · TK1151

Golgi apparatus0.092

Rank 5 · TkAUNG053040 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF10151TMEM21411-41 aa

PF23116HHD_RTEL125-164 aa

PF10151TMEM21459-558 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkAUNG053040	`PF10151`	TMEM214	11	41	9e-22	78.0
TkAUNG053040	`PF23116`	HHD_RTEL1	25	164	5.6	8.1
TkAUNG053040	`PF10151`	TMEM214	59	558	9e-22	78.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card