TkAUNG051620 | RubberDandelionOmics

Gene overview

TkAUNG051620

Reference: TK1151 Chr: ChrUn Coordinates: 14757293-14758528 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

765 bp · TkAUNG051620|TK1151|cDNA

ATGGATCAAGATCCTAACACCCCTCCACCAAACCAAAACCAACAATCTTTGGGAGAATTAATTTCTGTGTTAAGGCAAGGAGGATTGTCACCAAATATACCCAATCAACGCCAATTTACCCCAACTGTATCACCTACTATACCCTTCCAAAACCTCCAACAAAACTTCAATTCCCAAGCCATTTACAACCAAAACTTTAACGACCCACGAGCATTTGCACAACCCGAATTTCAAAACCCCAACTTTTATGGTGGAGGTTC...

CDS

Download CDS FASTA

765 bp · TkAUNG051620|TK1151|CDS

ATGGATCAAGATCCTAACACCCCTCCACCAAACCAAAACCAACAATCTTTGGGAGAATTAATTTCTGTGTTAAGGCAAGGAGGATTGTCACCAAATATACCCAATCAACGCCAATTTACCCCAACTGTATCACCTACTATACCCTTCCAAAACCTCCAACAAAACTTCAATTCCCAAGCCATTTACAACCAAAACTTTAACGACCCACGAGCATTTGCACAACCCGAATTTCAAAACCCCAACTTTTATGGTGGAGGTTC...

Protein

Download Protein FASTA

255 aa · TkAUNG051620|TK1151|PROTEIN

MDQDPNTPPPNQNQQSLGELISVLRQGGLSPNIPNQRQFTPTVSPTIPFQNLQQNFNSQAIYNQNFNDPRAFAQPEFQNPNFYGGGSSSAHNPQNETQMPPTQEVFPETQMPPSQETVPETQRPRREPKNDKIPWTEDERIALADAWCSTSQNPTQGNDQNKATYWQSIRAKLANTMGRDENYRSTNSITSKWTLMKTQLTKFNGIYMRLSRNPPSGWNEMKILDEAAEIYKAESKGNAFTLKKVWDRIRFEQKW

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkAUNG051620`
TK1151 ID	TkAUNG051620
OH-1004 ID	LXL04_037050
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	53.800
Protein coverage (%)	TK1151 96.078 / OH-1004 17.244 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkAUNG051620`
Location	ChrUn:14757293-14758528 (+)
Description	Similar to ATG18A: Autophagy-related protein 18a
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_037050` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0000045 autophagosome assembly Biological Process GO:0000422 autophagy of mitochondrion Biological Process GO:0000425 pexophagy Biological Process GO:0006914 autophagy Biological Process GO:0006970 response to osmotic stress Biological Process GO:0006979 response to oxidative stress Biological Process GO:0009267 cellular response to starvation Biological Process GO:0009414 response to water deprivation Biological Process GO:0009651 response to salt stress Biological Process GO:0010150 leaf senescence Biological Process GO:0010508 positive regulation of autophagy Biological Process GO:0015031 protein transport Biological Process
KEGG gene cross-reference	ath:AT2G40810 ath:AT3G56440 ath:AT3G62770 ath:AT5G05150 xla:447310 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.953

Rank 1 · TkAUNG051620 · TK1151

Cytoplasm0.156

Rank 2 · TkAUNG051620 · TK1151

Mitochondrion0.017

Rank 3 · TkAUNG051620 · TK1151

Cell membrane0.013

Rank 4 · TkAUNG051620 · TK1151

Extracellular0.009

Rank 5 · TkAUNG051620 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF13837Myb_DNA-bind_4134-204 aa

PF05880Fiji_64_capsid151-249 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkAUNG051620	`PF13837`	Myb_DNA-bind_4	134	204	8.3e-05	23.6
TkAUNG051620	`PF05880`	Fiji_64_capsid	151	249	0.034	13.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card