TkAUNG050160 | RubberDandelionOmics

Gene overview

TkAUNG050160

Reference: TK1151 Chr: ChrUn Coordinates: 14126132-14127732 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1002 bp · TkAUNG050160|TK1151|cDNA

GGAAAGAACAACTCTTTAGCTGTAAAACAGGAACAGCAGCCTAGTTCGCCTCTAGCAGGTCTTCCTGAGCTCTCTCACCTTGGCTGGGGTCACTGGTTTACTCTCAGGGATCTTGAAATCGCTACCGACAGGTTTTCCAAGGATAATGTTATTGGAGAGGGTGGATATGGAATTGTTTATCGCGGCCAACTTGTTAACGGTACAATTGTTGCTGTGAAAAGGCTCCTAAACAACTTAGGACAGGCTGAAAAGGAATTTAG...

CDS

Download CDS FASTA

1002 bp · TkAUNG050160|TK1151|CDS

GGAAAGAACAACTCTTTAGCTGTAAAACAGGAACAGCAGCCTAGTTCGCCTCTAGCAGGTCTTCCTGAGCTCTCTCACCTTGGCTGGGGTCACTGGTTTACTCTCAGGGATCTTGAAATCGCTACCGACAGGTTTTCCAAGGATAATGTTATTGGAGAGGGTGGATATGGAATTGTTTATCGCGGCCAACTTGTTAACGGTACAATTGTTGCTGTGAAAAGGCTCCTAAACAACTTAGGACAGGCTGAAAAGGAATTTAG...

Protein

Download Protein FASTA

333 aa · TkAUNG050160|TK1151|PROTEIN

GKNNSLAVKQEQQPSSPLAGLPELSHLGWGHWFTLRDLEIATDRFSKDNVIGEGGYGIVYRGQLVNGTIVAVKRLLNNLGQAEKEFSVEVEAIGHVRHKNLVRLLGYCIEGIHRLLVYEYVNNGNLEQWLHGAMSHHGHLTWEGRMKILCGTAKGLAYLHDAIEPKVVHRDIKASNILIDDDFNAKISDFGLAKMLGAGKSHIVTRVMGTFGYVAPEYASSGFLNEKSDVYSFGVVLLEAITGRDPVDDSRAVHEKSLVD...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkAUNG050160`
TK1151 ID	TkAUNG050160
OH-1004 ID	LXL04_039087
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	81.400
Protein coverage (%)	TK1151 93.393 / OH-1004 60.980 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkAUNG050160

Location ChrUn:14126132-14127732 (+)

Description Similar to At2g42960: Probable receptor-like protein kinase At2g42960

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g42960`	Probable receptor-like protein kinase At2g42960.	No verified direct reference in this release
`At5g18500`	Probable receptor-like protein kinase At5g18500.	No verified direct reference in this release
`At3g17420`	Probable receptor-like protein kinase At3g17420.	No verified direct reference in this release
`At1g01540`	Probable serine/threonine-protein kinase At1g01540.	No verified direct reference in this release
`At4g34500`	Probable receptor-like serine/threonine-protein kinase At4g34500.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_039087 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0046777 protein autophosphorylation Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005829 cytosol Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009506 plasmodesma Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0009514 glyoxysome Cellular Component

GO:0016020 membrane Cellular Component

GO:0004674 protein serine/threonine kinase activity Molecular Function

GO:0005524 ATP binding Molecular Function

GO:0106310 protein serine kinase activity Molecular Function

KEGG gene cross-reference

ath:AT1G01540

ath:AT2G42960

ath:AT3G17420

ath:AT4G34500

ath:AT5G18500

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.645

Rank 1 · TkAUNG050160 · TK1151

Cytoplasm0.322

Rank 2 · TkAUNG050160 · TK1151

Nucleus0.223

Rank 3 · TkAUNG050160 · TK1151

Endoplasmic reticulum0.039

Rank 4 · TkAUNG050160 · TK1151

Golgi apparatus0.037

Rank 5 · TkAUNG050160 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00069Pkinase46-314 aa

PF07714PK_Tyr_Ser-Thr48-316 aa

PF03109ABC156-79 aa

PF12260PIP49_C101-190 aa

PF03109ABC1157-198 aa

PF17667Pkinase_fungal164-217 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkAUNG050160	`PF00069`	Pkinase	46	314	3.3e-48	165.1
TkAUNG050160	`PF07714`	PK_Tyr_Ser-Thr	48	316	5.1e-46	157.8
TkAUNG050160	`PF03109`	ABC1	56	79	9e-05	22.5
TkAUNG050160	`PF12260`	PIP49_C	101	190	0.2	12.0
TkAUNG050160	`PF03109`	ABC1	157	198	9e-05	22.5
TkAUNG050160	`PF17667`	Pkinase_fungal	164	217	0.1	12.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SJG2`	Arabidopsis thaliana	sp\|Q9SJG2\|Y2296_ARATH Probable receptor-like protein kinase At2g42960	77.600%	Swiss-Prot	High
`Q8LEB6`	Arabidopsis thaliana	sp\|Q8LEB6\|Y5185_ARATH Probable receptor-like protein kinase At5g18500	78.500%	Swiss-Prot	High
`Q9LRP3`	Arabidopsis thaliana	sp\|Q9LRP3\|Y3174_ARATH Probable receptor-like protein kinase At3g17420	72.100%	Swiss-Prot	High
`Q3EDL4`	Arabidopsis thaliana	sp\|Q3EDL4\|Y1154_ARATH Probable serine/threonine-protein kinase At1g01540	66.200%	Swiss-Prot	High
`Q6NKZ9`	Arabidopsis thaliana	sp\|Q6NKZ9\|Y4345_ARATH Probable receptor-like serine/threonine-protein kinase At4g34500	62.900%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card