TkAUNG050080 | RubberDandelionOmics

Gene overview

TkAUNG050080

Reference: TK1151 Chr: ChrUn Coordinates: 14067752-14070503 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

735 bp · TkAUNG050080|TK1151|cDNA

ATGACGACACAATTAATTAAAGAATGGAGTGCAATTCAACAGTTTCCTGCAGCCACTCAGGAGAAACTGGTTGATTTGTTGGCAAAATTAAAGAACCAGGAACGTCAACACATTAACGATCCTTGTAATGGGGAAAGCCGGTGTGGTAAATCTTCCACTGTCAATTCTATTATAGGGGAAAGAGTGGTGACTGTAAGTGCTTTCCAGGTATATAGCATTTGGGCGGTGATGGTTTCACGGTCCCGATCAGGTTTTACATT...

CDS

Download CDS FASTA

735 bp · TkAUNG050080|TK1151|CDS

ATGACGACACAATTAATTAAAGAATGGAGTGCAATTCAACAGTTTCCTGCAGCCACTCAGGAGAAACTGGTTGATTTGTTGGCAAAATTAAAGAACCAGGAACGTCAACACATTAACGATCCTTGTAATGGGGAAAGCCGGTGTGGTAAATCTTCCACTGTCAATTCTATTATAGGGGAAAGAGTGGTGACTGTAAGTGCTTTCCAGGTATATAGCATTTGGGCGGTGATGGTTTCACGGTCCCGATCAGGTTTTACATT...

Protein

Download Protein FASTA

244 aa · TkAUNG050080|TK1151|PROTEIN

MTTQLIKEWSAIQQFPAATQEKLVDLLAKLKNQERQHINDPCNGESRCGKSSTVNSIIGERVVTVSAFQVYSIWAVMVSRSRSGFTLNIIDTPGLIEGGYVNDQVLDTIKRFLMTKTIDVLLYVDRLDAYRVDNLDKQVVKAIADSFGKEIWHKAMIVLTHAQLSPPDALSYEEFFSKRSESLLKCVFDKELGLAKRKFRALLSPLLLWLRTVGDATRTNMMRRSFQLVLHGSLIWYILSRMLP

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkAUNG050080`
TK1151 ID	TkAUNG050080
OH-1004 ID	LXL04_033223
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	65.600
Protein coverage (%)	TK1151 77.459 / OH-1004 58.514 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkAUNG050080

Location ChrUn:14067752-14070503 (-)

Description Similar to TOC34: Translocase of chloroplast 34, chloroplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g05000`	GTPase involved in protein precursor import into chloroplasts.	Two Toc34 homologues with different properties.2003 · DOI: 10.1021/bi034001q The Arabidopsis ppi1 mutant is specifically defective in the expression, chloroplast import, and accumulation of photosynthetic proteins.2003 · DOI: 10.1105/tpc.012955 An outer envelope membrane component of the plastid protein import apparatus plays an essential role in Arabidopsis.2004 · DOI: 10.1111/j.1365-313x.2004.02024.x Deletion of core components of the plastid protein import machinery causes differential arrest of embryo development in Arabidopsis thaliana.2006 · DOI: 10.1055/s-2005-873044
`At1g02280`	GTPase involved in protein precursor import into chloroplasts.	Chloroplast protein translocon components atToc159 and atToc33 are not essential for chloroplast biogenesis in guard cells and root cells.2001 · DOI: 10.1104/pp.127.1.90 Two Toc34 homologues with different properties.2003 · DOI: 10.1021/bi034001q Unusual nucleotide-binding properties of the chloroplast protein import receptor, atToc33.2003 · DOI: 10.1016/s0014-5793(03)00478-2 Dimerization of Toc-GTPases at the chloroplast protein import machinery.2003 · DOI: 10.1074/jbc.m305946200 The Arabidopsis ppi1 mutant is specifically defective in the expression, chloroplast import, and accumulation of photosynthetic proteins.2003 · DOI: 10.1105/tpc.012955 The roles of toc34 and toc75 in targeting the toc159 preprotein receptor to chloroplasts.2003 · DOI: 10.1074/jbc.m307873200 An outer envelope membrane component of the plastid protein import apparatus plays an essential role in Arabidopsis.2004 · DOI: 10.1111/j.1365-313x.2004.02024.x In vivo assessment of the significance of phosphorylation of the Arabidopsis chloroplast protein import receptor, atToc33.2006 · DOI: 10.1016/j.febslet.2005.12.055 Phospho-mimicry mutant of atToc33 affects early development of Arabidopsis thaliana.2007 · DOI: 10.1016/j.febslet.2007.11.071

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_033223 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006886 intracellular protein transport Biological Process

GO:0015031 protein transport Biological Process

GO:0019750 chloroplast localization Biological Process

GO:0045036 protein targeting to chloroplast Biological Process

GO:0045037 protein import into chloroplast stroma Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0009536 plastid Cellular Component

GO:0009707 chloroplast outer membrane Cellular Component

GO:0009941 chloroplast envelope Cellular Component

GO:0003924 GTPase activity Molecular Function

KEGG gene cross-reference

ath:AT1G02280

ath:AT5G05000

cre:CHLRE_06g252200v5

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.396

Rank 1 · TkAUNG050080 · TK1151

Nucleus0.239

Rank 2 · TkAUNG050080 · TK1151

Mitochondrion0.217

Rank 3 · TkAUNG050080 · TK1151

Cell membrane0.135

Rank 4 · TkAUNG050080 · TK1151

Endoplasmic reticulum0.120

Rank 5 · TkAUNG050080 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF03193RsgA_GTPase28-97 aa

PF04548AIG144-189 aa

PF01926MMR_HSR144-145 aa

PF00350Dynamin_N44-66 aa

PF02421FeoB_N44-124 aa

PF00350Dynamin_N86-128 aa

PF03193RsgA_GTPase108-146 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkAUNG050080	`PF03193`	RsgA_GTPase	28	97	0.019	15.5
TkAUNG050080	`PF04548`	AIG1	44	189	3.3e-29	102.5
TkAUNG050080	`PF01926`	MMR_HSR1	44	145	1.2e-08	35.7
TkAUNG050080	`PF00350`	Dynamin_N	44	66	0.00024	21.9
TkAUNG050080	`PF02421`	FeoB_N	44	124	0.021	15.1
TkAUNG050080	`PF00350`	Dynamin_N	86	128	0.00024	21.9
TkAUNG050080	`PF03193`	RsgA_GTPase	108	146	0.019	15.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q38906`	Arabidopsis thaliana	sp\|Q38906\|TOC34_ARATH Translocase of chloroplast 34, chloroplastic	58.000%	Swiss-Prot	High
`O23680`	Arabidopsis thaliana	sp\|O23680\|TOC33_ARATH Translocase of chloroplast 33, chloroplastic	63.400%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card