TkAUNG047990 | RubberDandelionOmics

Gene overview

TkAUNG047990

Reference: TK1151 Chr: ChrUn Coordinates: 13324837-13326307 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

733 bp · TkAUNG047990|TK1151|cDNA

TGCTCGCCATCTAGAAATAGTTTGCGTCGATTTTACTCGATTATTTAGGGTTTAAAAACAAACGCCAAGAAGATGTTTTCAAAAGATTTCTATCCCCCCACAAATTTTCTCCTCGCGCCTCTCTCTTCTCCCCCAAATTAGTTCTAATTTTCTAGAAAACCCCATAAGAATCTGGAGACGAATCCAATCTGTGTCTTCGTCTTTGTTCAATTTGCACCGCATCCTTTTTTAGCGTGCAATTGACGCCCAGAGTTTCAAAT...

CDS

Download CDS FASTA

408 bp · TkAUNG047990|TK1151|CDS

ATGAAGAAGGGAGCTAAGAGAAAAGCTGCTGCGGCGAGCCGTAAGGATGAATTAGCTTCTACTTCTACAGAACCCGCTGCCGCCGCCACCACCACCACCGAAGCACCGGAGGAGCAACATAACAAGGAACACATAAAAGTCGGTCGACCAACAAAACGTTCGAAAGTTCCGAAGCCTGAATCTGAACCCGAGTACTTCGAGGATCAGCGTGAATTGGAGGACTTATGGAAGCAGGTCTTTCCTGTTGGGACAGAGTGGGA...

Protein

Download Protein FASTA

135 aa · TkAUNG047990|TK1151|PROTEIN

MKKGAKRKAAAASRKDELASTSTEPAAAATTTTEAPEEQHNKEHIKVGRPTKRSKVPKPESEPEYFEDQRELEDLWKQVFPVGTEWDQLDLLSEYKWNFSNLENAFDEGGVLHGKKVYLFSCTEPQLLFLVVNQK

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkAUNG047990`
TK1151 ID	TkAUNG047990
OH-1004 ID	LXL04_007460
Relationship / confidence	Multi Candidate From Tk1151 / Complex relationship
Protein identity (%)	87.000
Protein coverage (%)	TK1151 95.556 / OH-1004 38.727 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkAUNG047990

Location ChrUn:13324837-13326307 (+)

Description Similar to HIT4: Protein HEAT INTOLERANT 4

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g10010`	Essential protein required for basal thermotolerance, especially during heat-induced chromocentre decondensation, thus regulating transcriptional gene silencing (TGS).	Arabidopsis HIT4 encodes a novel chromocentre-localized protein involved in the heat reactivation of transcriptionally silent loci and is essential for heat tolerance in plants.2013 · DOI: 10.1093/jxb/ert030 Arabidopsis HIT4, a regulator involved in heat-triggered reorganization of chromatin and release of transcriptional gene silencing, relocates from chromocenters to the nucleolus in response to heat stress.2015 · DOI: 10.1111/nph.13088

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_007460 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0009408 response to heat Biological Process

GO:0010286 heat acclimation Biological Process

GO:0031452 negative regulation of heterochromatin formation Biological Process

GO:0045814 negative regulation of gene expression, epigenetic Biological Process

GO:1900034 regulation of cellular response to heat Biological Process

GO:0005730 nucleolus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0010369 chromocenter Cellular Component

KEGG gene cross-reference

ath:AT5G10010

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.822

Rank 1 · TkAUNG047990 · TK1151

Cytoplasm0.254

Rank 2 · TkAUNG047990 · TK1151

Mitochondrion0.040

Rank 3 · TkAUNG047990 · TK1151

Cell membrane0.031

Rank 4 · TkAUNG047990 · TK1151

Endoplasmic reticulum0.022

Rank 5 · TkAUNG047990 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF21827New_glue15-58 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkAUNG047990	`PF21827`	New_glue	15	58	0.087	13.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`A2RVJ8`	Arabidopsis thaliana	sp\|A2RVJ8\|HIT4_ARATH Protein HEAT INTOLERANT 4	67.600%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card