TkAUNG047360 | RubberDandelionOmics

Gene overview

TkAUNG047360

Reference: TK1151 Chr: ChrUn Coordinates: 13112879-13127505 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1697 bp · TkAUNG047360|TK1151|cDNA

AAAAAATAAAGTTTTAGAATAATTTTTTGGCAGTTGAAGTTAAAAGTGCCGGGAGGGAGGAGGAGATTACAAGACTCTTGCCTCCCAACGTCTTTAAAAAAATGACATATGAGGCGATTAGTTTAACATCGACTAATCACAATTCTCCGTTTTTTTTTTCTGGGTAATAAAGACTATTCAAGATTCATACCAATCGAGATCAGAAGCTTTCCAATTGAGCGATCAAGTTCGTTGAATGATCTCATAATCCATTTGCATTG...

CDS

Download CDS FASTA

2790 bp · TkAUNG047360|TK1151|CDS

ATGGGGGTTATGTCAAGACGGGTGTTGCCCGTCTGTAGCAACCTCTGTATATTCTGTCCTTCGATGCGAGCTAGGTCCAGACAGCCAGTTAAACGATACAAGAAGCTTCTTGCAGATATTTTTCCTCGATCACATAATGCTGAGCCGAATGATCGGAAGATTGGGAAGCTTTGTGAATATTCTTGTAAAAACCCTTTACGCATACCAAAGATCACAGATTACCTAGAACAAAAGTTTTACAAGGAGATGCGCAATAAAAA...

Protein

Download Protein FASTA

929 aa · TkAUNG047360|TK1151|PROTEIN

MGVMSRRVLPVCSNLCIFCPSMRARSRQPVKRYKKLLADIFPRSHNAEPNDRKIGKLCEYSCKNPLRIPKITDYLEQKFYKEMRNKNFVSVKAVSLVYGKLPSSCKEQMPLFASSLLGIVRTLLEQTENDEMRILACQTLVSFINNQVDNTYMFNLEGLIPKLCELAQEVGDDERALQLRSSGLQVLAFMVRFMGEQSHISMDFDHIVSVTLENFIHTSNVDHGSSVDVNKMITNVVNFKSDVSMGDAHKSPSYWSSVCL...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkAUNG047360`
TK1151 ID	TkAUNG047360
OH-1004 ID	LXL04_023160
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	96.000
Protein coverage (%)	TK1151 100.000 / OH-1004 94.608 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkAUNG047360

Location ChrUn:13112879-13127505 (+)

Description Similar to SRL2: Protein SEMI-ROLLED LEAF 2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

No hit for this species in the current source table.

Rice

Reference gene ID	Possible function	Papers / DOI
`Os03g0308200`	Functions in regulating leaf rolling through abaxial side leaf cell differentiation.	Semi-Rolled Leaf2 modulates rice leaf rolling by regulating abaxial side cell differentiation.2016 · DOI: 10.1093/jxb/erw029

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_023160 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0030154 cell differentiation Biological Process

GO:0072659 protein localization to plasma membrane Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005886 plasma membrane Cellular Component

KEGG gene cross-reference

cbr:CBG_02625

cel:CELE_C32D5.3

dosa:Os03g0308200

osa:4332616

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.530

Rank 1 · TkAUNG047360 · TK1151

Nucleus0.307

Rank 2 · TkAUNG047360 · TK1151

Cell membrane0.211

Rank 3 · TkAUNG047360 · TK1151

Golgi apparatus0.103

Rank 4 · TkAUNG047360 · TK1151

Lysosome / Vacuole0.083

Rank 5 · TkAUNG047360 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF21052EFR3_ARM55-659 aa

PF23611zf-C2H2_1657-68 aa

PF03623Focal_AT75-116 aa

PF13513HEAT_EZ96-140 aa

PF25780TPR_IPO597-178 aa

PF03623Focal_AT229-250 aa

PF25780TPR_IPO5295-403 aa

PF03623Focal_AT339-379 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkAUNG047360	`PF21052`	EFR3_ARM	55	659	9.8e-76	256.5
TkAUNG047360	`PF23611`	zf-C2H2_16	57	68	0.28	12.0
TkAUNG047360	`PF03623`	Focal_AT	75	116	3.4	8.1
TkAUNG047360	`PF13513`	HEAT_EZ	96	140	0.1	13.9
TkAUNG047360	`PF25780`	TPR_IPO5	97	178	0.0012	19.9
TkAUNG047360	`PF03623`	Focal_AT	229	250	3.4	8.1
TkAUNG047360	`PF25780`	TPR_IPO5	295	403	0.0012	19.9
TkAUNG047360	`PF03623`	Focal_AT	339	379	3.4	8.1
TkAUNG047360	`PF13513`	HEAT_EZ	462	481	0.1	13.9
TkAUNG047360	`PF25780`	TPR_IPO5	465	496	0.0012	19.9
TkAUNG047360	`PF03623`	Focal_AT	612	640	3.4	8.1
TkAUNG047360	`PF13513`	HEAT_EZ	686	703	0.1	13.9
TkAUNG047360	`PF03623`	Focal_AT	802	856	3.4	8.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q10MI0`	Oryza sativa subsp. japonica	sp\|Q10MI0\|SRL2_ORYSJ Protein SEMI-ROLLED LEAF 2	32.200%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card