TkAUNG047250 | RubberDandelionOmics

Gene overview

TkAUNG047250

Reference: TK1151 Chr: ChrUn Coordinates: 13090225-13092062 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

477 bp · TkAUNG047250|TK1151|cDNA

ATGAAAATCTGGCCTCACAGTTTTGAGTTCCGCCTACGGGTAACTTTGGGACCTGCTGGAGATCTGATGTTGACTTCTCGTATCAGAAACACCAACGCCGATGGAAAGCCGTTTACTTTCACATTTGCTTATCATACATATTTCTCTGTTTCGGATATCAGTGAAGTACGTGTTGAAGGATTGGAGACACTGGATTATCTGGATAATTTGCAGAACAGGCAGCGATTTACTGAACAAGGTGATGCAATCACATTTGAATC...

CDS

Download CDS FASTA

477 bp · TkAUNG047250|TK1151|CDS

ATGAAAATCTGGCCTCACAGTTTTGAGTTCCGCCTACGGGTAACTTTGGGACCTGCTGGAGATCTGATGTTGACTTCTCGTATCAGAAACACCAACGCCGATGGAAAGCCGTTTACTTTCACATTTGCTTATCATACATATTTCTCTGTTTCGGATATCAGTGAAGTACGTGTTGAAGGATTGGAGACACTGGATTATCTGGATAATTTGCAGAACAGGCAGCGATTTACTGAACAAGGTGATGCAATCACATTTGAATC...

Protein

Download Protein FASTA

158 aa · TkAUNG047250|TK1151|PROTEIN

MKIWPHSFEFRLRVTLGPAGDLMLTSRIRNTNADGKPFTFTFAYHTYFSVSDISEVRVEGLETLDYLDNLQNRQRFTEQGDAITFESEVDKIYLSTPTKIAILDHEKKRTFVIRKDGLPDAVVWNPWDKKAKAILTLEMMSISICCALRQLQWKNLSL

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkAUNG047250`
TK1151 ID	TkAUNG047250
OH-1004 ID	LXL04_017997
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	84.300
Protein coverage (%)	TK1151 84.810 / OH-1004 42.006 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkAUNG047250`
Location	ChrUn:13090225-13092062 (+)
Description	Similar to Putative glucose-6-phosphate 1-epimerase
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_017997` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0005975 carbohydrate metabolic process Biological Process GO:0006974 DNA damage response Biological Process GO:0005634 nucleus Cellular Component GO:0005737 cytoplasm Cellular Component GO:0005829 cytosol Cellular Component GO:0030246 carbohydrate binding Molecular Function GO:0047938 glucose-6-phosphate 1-epimerase activity Molecular Function
KEGG gene cross-reference	ecj:JW1769 eco:b1780 ecoc:C3026_10155 hin:HI_1317 sce:YMR099C stm:STM1289 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.641

Rank 1 · TkAUNG047250 · TK1151

Nucleus0.233

Rank 2 · TkAUNG047250 · TK1151

Mitochondrion0.151

Rank 3 · TkAUNG047250 · TK1151

Peroxisome0.117

Rank 4 · TkAUNG047250 · TK1151

Cell membrane0.058

Rank 5 · TkAUNG047250 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01263Aldose_epim4-132 aa

PF08928PoNi_N106-156 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkAUNG047250	`PF01263`	Aldose_epim	4	132	5.2e-32	112.1
TkAUNG047250	`PF08928`	PoNi_N	106	156	0.2	12.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card