TkAUNG047210 | RubberDandelionOmics

Gene overview

TkAUNG047210

Reference: TK1151 Chr: ChrUn Coordinates: 13059981-13061743 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1344 bp · TkAUNG047210|TK1151|cDNA

ATGAAGCTAAGAGAGTTGAATCCAACTCTGGTTACTTACAATGTGATGTTGGATGTTTATGGGAAAAAGGGTCGATCTTGGGACAAAATTTTAGACCTTTTGGATGAGATGAGGAGTGTCGGGCTTGAATTCGATGAGTTCACTTGTAGCACTGTGATATCTGCTTGTGGGAGAGAAGGATTGTTGGAGGAAGCAAAGAGTTTCTTCAATGAACTTAAGTTAAATGGCTATGTCCCAGGGACGGTAACTTATAATTCTTT...

CDS

Download CDS FASTA

1344 bp · TkAUNG047210|TK1151|CDS

ATGAAGCTAAGAGAGTTGAATCCAACTCTGGTTACTTACAATGTGATGTTGGATGTTTATGGGAAAAAGGGTCGATCTTGGGACAAAATTTTAGACCTTTTGGATGAGATGAGGAGTGTCGGGCTTGAATTCGATGAGTTCACTTGTAGCACTGTGATATCTGCTTGTGGGAGAGAAGGATTGTTGGAGGAAGCAAAGAGTTTCTTCAATGAACTTAAGTTAAATGGCTATGTCCCAGGGACGGTAACTTATAATTCTTT...

Protein

Download Protein FASTA

447 aa · TkAUNG047210|TK1151|PROTEIN

MKLRELNPTLVTYNVMLDVYGKKGRSWDKILDLLDEMRSVGLEFDEFTCSTVISACGREGLLEEAKSFFNELKLNGYVPGTVTYNSLLQVYGKAGIYNEALSVLKDMEENNCPPDSVTYNELVAAYVRAGFNEEGATLIGTMTLKGIMPNAVTYTTVIDAYGKAGREDKALSLFKQMKESGCVPNVCTYNSILGMLGKKSRIEDMIEIINDMKSNGCKPNRITWNTMLAMCGNSGMHKGMERAFQEFLKNGYKPDLVIFN...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkAUNG047210`
TK1151 ID	TkAUNG047210
OH-1004 ID	LXL04_028380
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	77.500
Protein coverage (%)	TK1151 17.897 / OH-1004 9.434 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkAUNG047210

Location ChrUn:13059981-13061743 (-)

Description Similar to At2g18940: Pentatricopeptide repeat-containing protein At2g18940, chloroplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g18940`	Pentatricopeptide repeat-containing protein At2g18940, chloroplastic.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_028380 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006397 mRNA processing Biological Process

GO:0048255 mRNA stabilization Biological Process

GO:0009507 chloroplast Cellular Component

GO:0009570 chloroplast stroma Cellular Component

GO:0003729 mRNA binding Molecular Function

GO:0042802 identical protein binding Molecular Function

KEGG gene cross-reference

ath:AT2G18940

ath:AT5G02860

zma:100302579

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Mitochondrion0.719

Rank 1 · TkAUNG047210 · TK1151

Plastid0.174

Rank 2 · TkAUNG047210 · TK1151

Nucleus0.077

Rank 3 · TkAUNG047210 · TK1151

Cytoplasm0.039

Rank 4 · TkAUNG047210 · TK1151

Cell membrane0.013

Rank 5 · TkAUNG047210 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF13812PPR_31-22 aa

PF17177PPR_long1-60 aa

PF29978ATP18_TPR1-18 aa

PF12854PPR_15-37 aa

PF13041PPR_28-57 aa

PF01535PPR11-41 aa

PF23276TPR_2411-45 aa

PF19189Mtf212-52 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkAUNG047210	`PF13812`	PPR_3	1	22	1.6e-73	243.4
TkAUNG047210	`PF17177`	PPR_long	1	60	9.5e-28	97.7
TkAUNG047210	`PF29978`	ATP18_TPR	1	18	4.8e-11	43.4
TkAUNG047210	`PF12854`	PPR_1	5	37	3.9e-80	263.9
TkAUNG047210	`PF13041`	PPR_2	8	57	2.8e-108	354.6
TkAUNG047210	`PF01535`	PPR	11	41	2.4e-80	260.1
TkAUNG047210	`PF23276`	TPR_24	11	45	6.3e-33	114.2
TkAUNG047210	`PF19189`	Mtf2	12	52	4.4e-06	27.3
TkAUNG047210	`PF06239`	ECSIT_N	14	25	1.1e-05	25.6
TkAUNG047210	`PF18026`	Exog_C	25	48	0.18	12.4
TkAUNG047210	`PF29834`	SOV1_C	28	45	0.04	13.6
TkAUNG047210	`PF29070`	MSC6_N	29	130	1.6e-27	97.3
TkAUNG047210	`PF13812`	PPR_3	33	93	1.6e-73	243.4
TkAUNG047210	`PF12854`	PPR_1	41	72	3.9e-80	263.9
TkAUNG047210	`PF13041`	PPR_2	45	84	2.8e-108	354.6
TkAUNG047210	`PF01535`	PPR	47	76	2.4e-80	260.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`O64624`	Arabidopsis thaliana	sp\|O64624\|PP163_ARATH Pentatricopeptide repeat-containing protein At2g18940, chloroplastic	73.800%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card