Gene Card
Gene overview
cDNA / CDS / Protein Sequences
3700 bp · TkAUNG044620|TK1151|cDNA
TTCCACCTTTTGAAACTTCACGACTTCCCCATCCTCCGTCACTATTAATCTATTATACAACTACAAGACCCCTCATAAATCCAGGCTCCCAAGCAAATTGTTTCGTATCAATTTTGACTTCCGATTTTTAACTTAATTCCTTCCCTCTCACGTACTCTCCTCTCTCTCTGTTCACGCACATACACACTCGATTGCAAATTGGTAATGTAAAGCTGCTTCGCCGGCGATTACCTGACCGGAAGTGACAGTTTTTCGTGGTG...
3153 bp · TkAUNG044620|TK1151|CDS
ATGTCGACGGAGCGTCTAATTTCGAAAGGTTCTTTGCAATCGCACCATGGGGCTCAGTCGCACCACTCTTCCCCTGAATCGATCCGTATCTTCGATGAACTCCCCACGGGTACCATTCTATCGGTATCCCGACCCGACGTCAGTGATATTGGACCCCTGCGTCTCTCTTACACCATTCAACTCGAATACAAACAGTTCAAATGGTGCTTGGTAAAGAAGGCGTCACAAGTTATCTACTTACATTTTGCATTAAAGAAACG...
Protein
Download Protein FASTA1050 aa · TkAUNG044620|TK1151|PROTEIN
MSTERLISKGSLQSHHGAQSHHSSPESIRIFDELPTGTILSVSRPDVSDIGPLRLSYTIQLEYKQFKWCLVKKASQVIYLHFALKKRAIVEEFHEKQEQVKDWLQHIGIGDQTAIEHDNDEPDDGAIPIHNDDSIKKRSVPTRAALSIIRPSIGRSTISERAKVAMQNYLNHFLGNIDIVNSREVCKFLEVSKLSFSPEYGPKLKEDYVLVQHLSHIQRDDEGADTGCFLCCCCRNNWQKVWAVLKPGFLGLLADPFGTK...
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | TkAUNG044620 |
|---|---|
| TK1151 ID | TkAUNG044620 |
| OH-1004 ID | LXL04_001278 |
| Relationship / confidence | Multi Source To Oh1004 / Complex relationship |
| Protein identity (%) | 99.600 |
| Protein coverage (%) | TK1151 100.000 / OH-1004 100.000Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | TK1151 / GWHBCHF00000000 |
SNP / Indel variants and carrier samplesCRA009020 · TK1151
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | TkAUNG044620 | |||||||||
|---|---|---|---|---|---|---|---|---|---|---|
| Location | ChrUn:12414282-12419908 (-) | |||||||||
| Description | Similar to PLPZETA2: Phospholipase D zeta 2 | |||||||||
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene Arabidopsis
RiceNo hit for this species in the current source table. | |||||||||
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · | |||||||||
| GO annotations (OH1004 source) | GO:0006654 phosphatidic acid biosynthetic process Biological Process GO:0006995 cellular response to nitrogen starvation Biological Process GO:0008610 lipid biosynthetic process Biological Process GO:0008654 phospholipid biosynthetic process Biological Process GO:0009395 phospholipid catabolic process Biological Process GO:0009733 response to auxin Biological Process GO:0016036 cellular response to phosphate starvation Biological Process GO:0019375 galactolipid biosynthetic process Biological Process GO:0030335 positive regulation of cell migration Biological Process GO:0031670 cellular response to nutrient Biological Process GO:0035556 intracellular signal transduction Biological Process GO:0043434 response to peptide hormone Biological Process | |||||||||
| KEGG gene cross-reference | ath:AT3G05630 ath:AT3G16785 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF00169PH237-325 aaPF11495TrmB_EBD_N364-387 aaPF13091PLDc_2376-487 aaPF00614PLDc377-572 aaPF11495TrmB_EBD_N409-438 aaPF19328DAP_DH_C568-611 aaPF00614PLDc714-837 aaPF11495TrmB_EBD_N715-738 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| TkAUNG044620 | PF00169 | PH | 237 | 325 | 0.0054 | 17.9 |
| TkAUNG044620 | PF11495 | TrmB_EBD_N | 364 | 387 | 0.12 | 12.8 |
| TkAUNG044620 | PF13091 | PLDc_2 | 376 | 487 | 2.6e-15 | 57.1 |
| TkAUNG044620 | PF00614 | PLDc | 377 | 572 | 9.5e-58 | 196.6 |
| TkAUNG044620 | PF11495 | TrmB_EBD_N | 409 | 438 | 0.12 | 12.8 |
| TkAUNG044620 | PF19328 | DAP_DH_C | 568 | 611 | 0.031 | 14.6 |
| TkAUNG044620 | PF00614 | PLDc | 714 | 837 | 9.5e-58 | 196.6 |
| TkAUNG044620 | PF11495 | TrmB_EBD_N | 715 | 738 | 0.12 | 12.8 |
| TkAUNG044620 | PF13091 | PLDc_2 | 725 | 753 | 2.6e-15 | 57.1 |
| TkAUNG044620 | PF13091 | PLDc_2 | 836 | 899 | 2.6e-15 | 57.1 |
| TkAUNG044620 | PF00614 | PLDc | 852 | 933 | 9.5e-58 | 196.6 |
| TkAUNG044620 | PF19328 | DAP_DH_C | 866 | 945 | 0.031 | 14.6 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.