TkAUNG044330 | RubberDandelionOmics

Gene overview

TkAUNG044330

Reference: TK1151 Chr: ChrUn Coordinates: 12326027-12329385 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2357 bp · TkAUNG044330|TK1151|cDNA

TCATCCTCCAAGCATGAATTCATACCTGTATTCTATAACGTGGACCTATCTGATATTCTTCATCAAACAGGAAGCTTTAAAAATGCATTTGATGGATATGATGATCTAATCAAGGAAGAAAAAAACCTTCGAGAGAAGATCAAATTGCTGAATAAGGTATGGGAATGGAGGGATTCTCTTGAAAAAGCTGCAACTTTTGCAGGAATCGAAATTAAAGCTCGGTCCGAGTCCAAGTTCATAAACAACATTGTGAATGTTGT...

CDS

Download CDS FASTA

2217 bp · TkAUNG044330|TK1151|CDS

TCATCCTCCAAGCATGAATTCATACCTGTATTCTATAACGTGGACCTATCTGATATTCTTCATCAAACAGGAAGCTTTAAAAATGCATTTGATGGATATGATGATCTAATCAAGGAAGAAAAAAACCTTCGAGAGAAGATCAAATTGCTGAATAAGGTATGGGAATGGAGGGATTCTCTTGAAAAAGCTGCAACTTTTGCAGGAATCGAAATTAAAGCTCGGTCCGAGTCCAAGTTCATAAACAACATTGTGAATGTTGT...

Protein

Download Protein FASTA

738 aa · TkAUNG044330|TK1151|PROTEIN

SSSKHEFIPVFYNVDLSDILHQTGSFKNAFDGYDDLIKEEKNLREKIKLLNKVWEWRDSLEKAATFAGIEIKARSESKFINNIVNVVIKKIGIKSPYIKDKLVGIKDDVAKIESWLQDPSPDAAVLIIHGVGGIGKTTIAEHIYNNLNHGSNYDATCFLANINDTSNQHGGLISLQSHLLSEVSNKKNEETIWNLEEGTKKVTDAISNKKVFLILDDVTTSEQLDVFLGPKSFYPGSKVIITTRHAWLLSKAFKVPPEVH...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkAUNG044330`
TK1151 ID	TkAUNG044330
OH-1004 ID	LXL04_001269
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	81.200
Protein coverage (%)	TK1151 98.916 / OH-1004 86.447 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkAUNG044330

Location ChrUn:12326027-12329385 (-)

Description Similar to RUN1: Disease resistance protein RUN1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g57580`	Transcription activator that binds DNA in a sequence-specific manner, likely 5'-GAAATTTTGG-3', to promote the expression of target genes.	No verified direct reference in this release
`At4g25800`	Transcription activator that binds DNA in a sequence-specific manner, likely 5'-GAAATTTTGG-3', to promote the expression of target genes.	No verified direct reference in this release
`At2g18750`	Transcription activator that binds DNA in a sequence-specific manner, likely 5'-GAAATTTTGG-3', to promote the expression of target genes.	No verified direct reference in this release
`At5g26920`	Transcription activator that binds DNA in a sequence-specific manner, 5'-GAAATTTTGG-3', to promote the expression of target genes.	Arabidopsis CaM binding protein CBP60g contributes to MAMP-induced SA accumulation and is involved in disease resistance against Pseudomonas syringae.2009 · DOI: 10.1371/journal.ppat.1000301 CBP60g and SARD1 play partially redundant critical roles in salicylic acid signaling.2011 · DOI: 10.1111/j.1365-313x.2011.04655.x Calmodulin-binding protein CBP60g is a positive regulator of both disease resistance and drought tolerance in Arabidopsis.2012 · DOI: 10.1007/s00299-012-1247-7 Co-expression analysis identifies putative targets for CBP60g and SARD1 regulation.2012 · DOI: 10.1186/1471-2229-12-216 The plant-specific transcription factors CBP60g and SARD1 are targeted by a Verticillium secretory protein VdSCP41 to modulate immunity.2018 · DOI: 10.7554/elife.34902

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_001269 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0006952 defense response Biological Process

GO:0007165 signal transduction Biological Process

GO:0019677 NAD+ catabolic process Biological Process

GO:0043068 positive regulation of programmed cell death Biological Process

GO:0050832 defense response to fungus Biological Process

GO:0080142 regulation of salicylic acid biosynthetic process Biological Process

GO:0098542 defense response to other organism Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0003700 DNA-binding transcription factor activity Molecular Function

GO:0003953 NAD+ nucleosidase activity Molecular Function

KEGG gene cross-reference

ath:AT5G57580

ghi:107899061

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.510

Rank 1 · TkAUNG044330 · TK1151

Nucleus0.454

Rank 2 · TkAUNG044330 · TK1151

Cell membrane0.140

Rank 3 · TkAUNG044330 · TK1151

Endoplasmic reticulum0.070

Rank 4 · TkAUNG044330 · TK1151

Extracellular0.032

Rank 5 · TkAUNG044330 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01582TIR6-100 aa

PF00931NB-ARC106-282 aa

PF13191AAA_16106-150 aa

PF06309Torsin109-150 aa

PF01637ATPase_2110-221 aa

PF24883NPHP3_N111-199 aa

PF04851ResIII112-191 aa

PF13401AAA_22123-218 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkAUNG044330	`PF01582`	TIR	6	100	2.3e-07	31.5
TkAUNG044330	`PF00931`	NB-ARC	106	282	3.7e-22	79.4
TkAUNG044330	`PF13191`	AAA_16	106	150	0.0064	17.7
TkAUNG044330	`PF06309`	Torsin	109	150	0.032	15.0
TkAUNG044330	`PF01637`	ATPase_2	110	221	1.9e-05	25.3
TkAUNG044330	`PF24883`	NPHP3_N	111	199	9.7e-07	29.8
TkAUNG044330	`PF04851`	ResIII	112	191	0.043	14.4
TkAUNG044330	`PF13401`	AAA_22	123	218	0.0044	18.0
TkAUNG044330	`PF13173`	AAA_14	124	250	0.0029	18.3
TkAUNG044330	`PF05729`	NACHT	125	246	5.2e-05	23.9
TkAUNG044330	`PF20720`	nSTAND3	125	165	0.0006	20.3
TkAUNG044330	`PF00005`	ABC_tran	125	207	0.085	14.2
TkAUNG044330	`PF01443`	Viral_helicase1	127	219	0.087	13.3
TkAUNG044330	`PF00910`	RNA_helicase	127	189	0.17	13.1
TkAUNG044330	`PF00004`	AAA	127	191	0.23	12.6
TkAUNG044330	`PF07887`	Calmodulin_bind	427	572	1.8e-47	161.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FKL6`	Arabidopsis thaliana	sp\|Q9FKL6\|CB60B_ARATH Calmodulin-binding protein 60 B	39.600%	Swiss-Prot	Low
`Q0WVV6`	Arabidopsis thaliana	sp\|Q0WVV6\|CB60D_ARATH Calmodulin-binding protein 60 D	41.300%	Swiss-Prot	Low
`C0SV51`	Arabidopsis thaliana	sp\|C0SV51\|CB60C_ARATH Calmodulin-binding protein 60 C	39.600%	Swiss-Prot	Low
`F4K2R6`	Arabidopsis thaliana	sp\|F4K2R6\|CB60G_ARATH Calmodulin-binding protein 60 G	38.700%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card