TkAUNG043760 | RubberDandelionOmics

Gene overview

TkAUNG043760

Reference: TK1151 Chr: ChrUn Coordinates: 12167229-12170609 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1533 bp · TkAUNG043760|TK1151|cDNA

ATTCAACACTTTTCCTATTCTCGCTACATGTTCGATTTATCGAGTATCACTGATGTGAAGTTCGTTTTTTTTGCTCTAGTCATCACGGACGACGGGTCTACCTTCCCGGAGGTGCCATAAACTTCAAACTACCACCAATTATTGTGCGCGGCAGATTGAAGACAAATGAAAATGACGGCGGCGGAGGGAGACTGCAGACAGTGGGACGAAGACGCTTACAGAGACAGCATACTGGAGGAGAGGGAATCGCATTCTCTCAC...

CDS

Download CDS FASTA

1149 bp · TkAUNG043760|TK1151|CDS

ATGAAAATGACGGCGGCGGAGGGAGACTGCAGACAGTGGGACGAAGACGCTTACAGAGACAGCATACTGGAGGAGAGGGAATCGCATTCTCTCACCATCTTCCGAACTGCCTTCTCCCCGTCACCTACCTGCCAAAACCCTAAATTCATCGTCGCTGCCGCTAGCGATGGTTCCATCGCTACATACTCTTTATCCTCTCAAATCTCCTCCACCCCTTTAGGTTTTGGAAATTCAAAGACTCAAAATTTATCTGTAGCTGA...

Protein

Download Protein FASTA

382 aa · TkAUNG043760|TK1151|PROTEIN

MKMTAAEGDCRQWDEDAYRDSILEERESHSLTIFRTAFSPSPTCQNPKFIVAAASDGSIATYSLSSQISSTPLGFGNSKTQNLSVAEPNCLLHGHDGPAYDVKFYGDDEDSLLLSCGDDGRIRGWKWTDVLEADKDSLSQSEGQKPKLELANPQHKGPWGALSPIPETNAIAVDTQGGSIYAAAGDSCAYCWDVEESKIKMTFKGHAGYLHSIVARNSCNQIITGSEDGTARIWDCRSGKCSNVIEPWKDKKSKDFFSYV...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkAUNG043760`
TK1151 ID	TkAUNG043760
OH-1004 ID	LXL04_002397
Relationship / confidence	Rbh Sequence Supported / Probable
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkAUNG043760

Location ChrUn:12167229-12170609 (-)

Description Similar to THO6: THO complex subunit 6

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g19430`	Acts as a component of the THO subcomplex of the TREX complex which is thought to couple mRNA transcription, processing and nuclear export.	DWA1 and DWA2, two Arabidopsis DWD protein components of CUL4-based E3 ligases, act together as negative regulators in ABA signal transduction.2010 · DOI: 10.1105/tpc.109.073783

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_002397 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006397 mRNA processing Biological Process

GO:0006406 mRNA export from nucleus Biological Process

GO:0008380 RNA splicing Biological Process

GO:0009738 abscisic acid-activated signaling pathway Biological Process

GO:0009788 negative regulation of abscisic acid-activated signaling pathway Biological Process

GO:0010267 ta-siRNA processing Biological Process

GO:0016567 protein ubiquitination Biological Process

GO:0031047 regulatory ncRNA-mediated gene silencing Biological Process

GO:0000346 transcription export complex Cellular Component

GO:0000347 THO complex Cellular Component

GO:0000445 THO complex part of transcription export complex Cellular Component

GO:0000781 chromosome, telomeric region Cellular Component

KEGG gene cross-reference

ath:AT2G19430

dre:100004014

hsa:79228

mmu:386612

rno:79227

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.602

Rank 1 · TkAUNG043760 · TK1151

Cytoplasm0.348

Rank 2 · TkAUNG043760 · TK1151

Cell membrane0.070

Rank 3 · TkAUNG043760 · TK1151

Lysosome / Vacuole0.048

Rank 4 · TkAUNG043760 · TK1151

Endoplasmic reticulum0.041

Rank 5 · TkAUNG043760 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF25172Beta-prop_WDR3_2nd6-64 aa

PF25174Beta-prop_THOC311-69 aa

PF24814WD40_Prp1920-67 aa

PF23393Beta-prop_WDR90_POC16_2nd21-71 aa

PF23381Beta-prop_IFT122_1st25-71 aa

PF25173Beta-prop_WDR3_1st27-68 aa

PF00400WD4028-59 aa

PF23342WDR90_beta-prop_4th37-67 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkAUNG043760	`PF25172`	Beta-prop_WDR3_2nd	6	64	1.8e-11	44.5
TkAUNG043760	`PF25174`	Beta-prop_THOC3	11	69	1.7e-15	57.5
TkAUNG043760	`PF24814`	WD40_Prp19	20	67	9.4e-16	58.4
TkAUNG043760	`PF23393`	Beta-prop_WDR90_POC16_2nd	21	71	0.0038	17.2
TkAUNG043760	`PF23381`	Beta-prop_IFT122_1st	25	71	2.7e-16	60.4
TkAUNG043760	`PF25173`	Beta-prop_WDR3_1st	27	68	1.3e-17	64.8
TkAUNG043760	`PF00400`	WD40	28	59	1.6e-16	60.7
TkAUNG043760	`PF23342`	WDR90_beta-prop_4th	37	67	0.00015	21.7
TkAUNG043760	`PF23609`	Beta-prop_EIPR1	38	72	0.00015	22.1
TkAUNG043760	`PF13570`	Beta-prop_ACSF4	44	65	0.0002	21.6
TkAUNG043760	`PF24796`	WDR55	45	66	2.9e-12	47.0
TkAUNG043760	`PF24805`	EIF3I	45	67	1.6e-10	41.3
TkAUNG043760	`PF23414`	Beta-prop_EML_2	45	69	9.9e-08	32.4
TkAUNG043760	`PF25168`	Beta-prop_WDR36-Utp21_2nd	46	66	6.7e-09	36.2
TkAUNG043760	`PF25047`	Beta-prop_TEP1_2nd	46	83	1.1e-07	32.0
TkAUNG043760	`PF25171`	Beta-prop_WDR36-Utp21_1st	46	125	4.4e-07	30.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8L4M1`	Arabidopsis thaliana	sp\|Q8L4M1\|THOC6_ARATH THO complex subunit 6	60.100%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card