TkAUNG041500 | RubberDandelionOmics

Gene overview

TkAUNG041500

Reference: TK1151 Chr: ChrUn Coordinates: 11548090-11549622 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

408 bp · TkAUNG041500|TK1151|cDNA

CAGAAAGGCATAGTGGTTGAGAAGCTGACTGAAGAGGTCATCAAAGATAGTCAACATCTAAGGTGCTTAATAGCAACTTGTGAAGCTCAAAGGCAATTGGGTGAAATTTCTTTGGATGATAGAAGTTCAAGCGACTTCTTTGAAATCCCAATAGATTCAGTATGCATTGCAGATGTTCAGTTCAAAGGACGAGGGCATTCACAAAATGTATGGGAATCTACAAAAGGCATACCACCTCTTGATGTTAGAATAAAATGGCC...

CDS

Download CDS FASTA

408 bp · TkAUNG041500|TK1151|CDS

CAGAAAGGCATAGTGGTTGAGAAGCTGACTGAAGAGGTCATCAAAGATAGTCAACATCTAAGGTGCTTAATAGCAACTTGTGAAGCTCAAAGGCAATTGGGTGAAATTTCTTTGGATGATAGAAGTTCAAGCGACTTCTTTGAAATCCCAATAGATTCAGTATGCATTGCAGATGTTCAGTTCAAAGGACGAGGGCATTCACAAAATGTATGGGAATCTACAAAAGGCATACCACCTCTTGATGTTAGAATAAAATGGCC...

Protein

Download Protein FASTA

135 aa · TkAUNG041500|TK1151|PROTEIN

QKGIVVEKLTEEVIKDSQHLRCLIATCEAQRQLGEISLDDRSSSDFFEIPIDSVCIADVQFKGRGHSQNVWESTKGIPPLDVRIKWPSDLYLNGLKVGGILCASTYQSNIFIISAGVGLNVDNDKPTSLNSELKK

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkAUNG041500`
TK1151 ID	TkAUNG041500
OH-1004 ID	LXL04_024894
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	60.400
Protein coverage (%)	TK1151 73.333 / OH-1004 33.985 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkAUNG041500

Location ChrUn:11548090-11549622 (+)

Description Similar to HCS1: Biotin--protein ligase 1, chloroplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g37150`	Seems to have no or limited implication in biotin-dependent carboxylase biotinylation in planta.	Dual targeting of Arabidopsis holocarboxylase synthetase1: a small upstream open reading frame regulates translation initiation and protein targeting.2008 · DOI: 10.1104/pp.107.111534
`At2g25710`	Plays a major role in biotin-dependent carboxylase biotinylation.	Dual targeting of Arabidopsis holocarboxylase synthetase1: a small upstream open reading frame regulates translation initiation and protein targeting.2008 · DOI: 10.1104/pp.107.111534

Rice

Reference gene ID	Possible function	Papers / DOI
`Os08g0547500`	Kinesin-like protein KIN-7H.	No verified direct reference in this release
`Os01g0513900`	May be essential to promote the progression of cytokinesis during node-internode differentiation.	The rice mutant dwarf bamboo shoot 1: a leaky mutant of the NACK-type kinesin-like gene can initiate organ primordia but not organ development.2005 · DOI: 10.1093/pcp/pci206
`Os09g0528000`	Kinesin-like protein KIN-7J.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_024894 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006768 biotin metabolic process Biological Process

GO:0042966 biotin carboxyl carrier protein biosynthetic process Biological Process

GO:0043687 post-translational protein modification Biological Process

GO:0051604 protein maturation Biological Process

GO:0070781 response to biotin Biological Process

GO:0000785 chromatin Cellular Component

GO:0005652 nuclear lamina Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0005829 cytosol Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0009536 plastid Cellular Component

KEGG gene cross-reference

ath:AT1G37150

ath:AT2G25710

hsa:3141

mmu:110948

spo:2540476

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.518

Rank 1 · TkAUNG041500 · TK1151

Nucleus0.302

Rank 2 · TkAUNG041500 · TK1151

Peroxisome0.142

Rank 3 · TkAUNG041500 · TK1151

Mitochondrion0.125

Rank 4 · TkAUNG041500 · TK1151

Extracellular0.056

Rank 5 · TkAUNG041500 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00225Kinesin2-43 aa

PF03099BPL_LplA_LipB52-76 aa

PF03099BPL_LplA_LipB79-120 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkAUNG041500	`PF00225`	Kinesin	2	43	0.03	14.0
TkAUNG041500	`PF03099`	BPL_LplA_LipB	52	76	3.2e-16	60.2
TkAUNG041500	`PF03099`	BPL_LplA_LipB	79	120	3.2e-16	60.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`F4I4W2`	Arabidopsis thaliana	sp\|F4I4W2\|HCS2_ARATH Biotin--protein ligase 2	46.400%	Swiss-Prot	Medium
`Q9SL92`	Arabidopsis thaliana	sp\|Q9SL92\|HCS1_ARATH Biotin--protein ligase 1, chloroplastic	45.700%	Swiss-Prot	Medium
`Q6Z9D2`	Oryza sativa subsp. japonica	sp\|Q6Z9D2\|KN7H_ORYSJ Kinesin-like protein KIN-7H	45.800%	Swiss-Prot	Medium
`Q9AWM8`	Oryza sativa subsp. japonica	sp\|Q9AWM8\|KN7A_ORYSJ Kinesin-like protein KIN-7A	65.100%	Swiss-Prot	Low
`Q651Z7`	Oryza sativa subsp. japonica	sp\|Q651Z7\|KN7J_ORYSJ Kinesin-like protein KIN-7J	45.700%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card