Gene Card
Gene overview
cDNA / CDS / Protein Sequences
561 bp · TkAUNG041390|TK1151|cDNA
CTCGAGAAACTAGAAGAAGCCAAGGCCACTATCCGCCTCTCAACTGGCATAGATGTCGCTATTGTGAGTGCCGACGTATGCGACTTTGAAGCTGTGAAACACGCAGTAGAGAATGTAGGTCCGATTGATGTTTCGGTTTGCAATCAAGGCGTGTTTGTTGCTCAAGAGCTTGAGAAACAGAAGATGGAGGAGATTAGAGGCATGATTGATATAAATCTGATTGGGACTTTTAATCTGGTGAAGGCGGCGTTACCAGGTAT...
561 bp · TkAUNG041390|TK1151|CDS
CTCGAGAAACTAGAAGAAGCCAAGGCCACTATCCGCCTCTCAACTGGCATAGATGTCGCTATTGTGAGTGCCGACGTATGCGACTTTGAAGCTGTGAAACACGCAGTAGAGAATGTAGGTCCGATTGATGTTTCGGTTTGCAATCAAGGCGTGTTTGTTGCTCAAGAGCTTGAGAAACAGAAGATGGAGGAGATTAGAGGCATGATTGATATAAATCTGATTGGGACTTTTAATCTGGTGAAGGCGGCGTTACCAGGTAT...
Protein
Download Protein FASTA186 aa · TkAUNG041390|TK1151|PROTEIN
LEKLEEAKATIRLSTGIDVAIVSADVCDFEAVKHAVENVGPIDVSVCNQGVFVAQELEKQKMEEIRGMIDINLIGTFNLVKAALPGMKNRTDRKPVSIAFMSSQAGQVGIYGYTAYSASKFALRGLAEALQHEVISHNIHLSLIFPPDTDTPGLTQENMSKPRLTRLIAASSSGAMKADEEVAKRA
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | TkAUNG041390 |
|---|---|
| TK1151 ID | TkAUNG041390 |
| OH-1004 ID | LXL04_031450 |
| Relationship / confidence | Multi Source To Oh1004 / Complex relationship |
| Protein identity (%) | 84.900 |
| Protein coverage (%) | TK1151 99.462 / OH-1004 56.135Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | TK1151 / GWHBCHF00000000 |
SNP / Indel variants and carrier samplesCRA009020 · TK1151
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | TkAUNG041390 | |||||||||
|---|---|---|---|---|---|---|---|---|---|---|
| Location | ChrUn:11519835-11520532 (-) | |||||||||
| Description | Similar to TSC10A: 3-dehydrosphinganine reductase TSC10A | |||||||||
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene Arabidopsis
RiceNo hit for this species in the current source table. | |||||||||
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · | |||||||||
| GO annotations (OH1004 source) | GO:0006666 3-keto-sphinganine metabolic process Biological Process GO:0006686 sphingomyelin biosynthetic process Biological Process GO:0006688 glycosphingolipid biosynthetic process Biological Process GO:0030148 sphingolipid biosynthetic process Biological Process GO:0046513 ceramide biosynthetic process Biological Process GO:0005615 extracellular space Cellular Component GO:0005783 endoplasmic reticulum Cellular Component GO:0005789 endoplasmic reticulum membrane Cellular Component GO:0009507 chloroplast Cellular Component GO:0016020 membrane Cellular Component GO:0098554 cytoplasmic side of endoplasmic reticulum membrane Cellular Component GO:0047560 3-dehydrosphinganine reductase activity Molecular Function | |||||||||
| KEGG gene cross-reference | ath:AT3G06060 ath:AT5G19200 hsa:2531 mmu:70750 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF00106adh_short2-157 aaPF13561adh_short_C27-184 aaPF08659KR14-132 aaPF16363GDP_Man_Dehyd17-85 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| TkAUNG041390 | PF00106 | adh_short | 2 | 157 | 4.2e-30 | 105.4 |
| TkAUNG041390 | PF13561 | adh_short_C2 | 7 | 184 | 2.3e-20 | 73.9 |
| TkAUNG041390 | PF08659 | KR | 14 | 132 | 1.9e-05 | 25.4 |
| TkAUNG041390 | PF16363 | GDP_Man_Dehyd | 17 | 85 | 0.11 | 12.6 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.