TkAUNG041110 | RubberDandelionOmics

Gene overview

TkAUNG041110

Reference: TK1151 Chr: ChrUn Coordinates: 11438281-11438898 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

519 bp · TkAUNG041110|TK1151|cDNA

AAAGATATTGTCTCCTACACAGTTATGATATTGGGCTACAGTCTACATGGAGAAGGCGAACTTGGAGTTACTTTATTCAAGAAAGTACCAAAAACATTAACAGACGAAATAAGCTATGTTACAGCTCTATACGCATGTTGTACTGCCCGCATGGTAGAAAAAGCTTTTGTTAAAGAACACGGTATAGAAAAGAACCCTGAGGTACTCAGAGCATTAATAGACGGATGCAGGATTCATAAAAACATAAAAATAGGGAAAAG...

CDS

Download CDS FASTA

495 bp · TkAUNG041110|TK1151|CDS

ATGATATTGGGCTACAGTCTACATGGAGAAGGCGAACTTGGAGTTACTTTATTCAAGAAAGTACCAAAAACATTAACAGACGAAATAAGCTATGTTACAGCTCTATACGCATGTTGTACTGCCCGCATGGTAGAAAAAGCTTTTGTTAAAGAACACGGTATAGAAAAGAACCCTGAGGTACTCAGAGCATTAATAGACGGATGCAGGATTCATAAAAACATAAAAATAGGGAAAAGATTGATAGAACAGCTTTGTGAAGT...

Protein

Download Protein FASTA

165 aa · TkAUNG041110|TK1151|PROTEIN

MILGYSLHGEGELGVTLFKKVPKTLTDEISYVTALYACCTARMVEKAFVKEHGIEKNPEVLRALIDGCRIHKNIKIGKRLIEQLCEVDPLNAENYVLMSNWHAENGKQEMVYKWRETIKDMDLKPKVAYSWIEFRNKVHVFKTGDVSHPRSESIYWELECLMKNL

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkAUNG041110`
TK1151 ID	TkAUNG041110
OH-1004 ID	LXL04_003073
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	81.800
Protein coverage (%)	TK1151 100.000 / OH-1004 34.555 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkAUNG041110

Location ChrUn:11438281-11438898 (-)

Description Similar to DOT4: Pentatricopeptide repeat-containing protein DOT4, chloroplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g33170`	Pentatricopeptide repeat-containing protein At4g33170.	No verified direct reference in this release
`At1g17630`	Putative pentatricopeptide repeat-containing protein At1g17630.	No verified direct reference in this release
`At1g19720`	Pentatricopeptide repeat-containing protein At1g19720.	No verified direct reference in this release
`At4g19191`	Pentatricopeptide repeat-containing protein At4g19191, mitochondrial.	No verified direct reference in this release
`At1g06143`	Pentatricopeptide repeat-containing protein At1g06143.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_003073 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006397 mRNA processing Biological Process

GO:0009451 RNA modification Biological Process

GO:0010087 phloem or xylem histogenesis Biological Process

GO:0010305 leaf vascular tissue pattern formation Biological Process

GO:0010588 cotyledon vascular tissue pattern formation Biological Process

GO:0048366 leaf development Biological Process

GO:1900865 chloroplast RNA modification Biological Process

GO:0005739 mitochondrion Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0003723 RNA binding Molecular Function

GO:0008270 zinc ion binding Molecular Function

KEGG gene cross-reference

ath:AT3G23330

ath:AT4G18750

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Mitochondrion0.624

Rank 1 · TkAUNG041110 · TK1151

Plastid0.111

Rank 2 · TkAUNG041110 · TK1151

Cytoplasm0.084

Rank 3 · TkAUNG041110 · TK1151

Nucleus0.040

Rank 4 · TkAUNG041110 · TK1151

Peroxisome0.022

Rank 5 · TkAUNG041110 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01535PPR1-20 aa

PF01535PPR30-48 aa

PF20431E_motif47-59 aa

PF01535PPR63-84 aa

PF20431E_motif71-133 aa

PF20430Eplus_motif138-163 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkAUNG041110	`PF01535`	PPR	1	20	0.008	17.1
TkAUNG041110	`PF01535`	PPR	30	48	0.008	17.1
TkAUNG041110	`PF20431`	E_motif	47	59	8.1e-09	36.3
TkAUNG041110	`PF01535`	PPR	63	84	0.008	17.1
TkAUNG041110	`PF20431`	E_motif	71	133	8.1e-09	36.3
TkAUNG041110	`PF20430`	Eplus_motif	138	163	0.0035	17.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SMZ2`	Arabidopsis thaliana	sp\|Q9SMZ2\|PP347_ARATH Pentatricopeptide repeat-containing protein At4g33170	29.900%	Swiss-Prot	Low
`Q9LNP2`	Arabidopsis thaliana	sp\|Q9LNP2\|PPR47_ARATH Putative pentatricopeptide repeat-containing protein At1g17630	34.300%	Swiss-Prot	Medium
`Q9FXH1`	Arabidopsis thaliana	sp\|Q9FXH1\|PPR52_ARATH Pentatricopeptide repeat-containing protein At1g19720	28.000%	Swiss-Prot	Low
`P0C8Q2`	Arabidopsis thaliana	sp\|P0C8Q2\|PP323_ARATH Pentatricopeptide repeat-containing protein At4g19191, mitochondrial	33.300%	Swiss-Prot	Medium
`Q56X05`	Arabidopsis thaliana	sp\|Q56X05\|PPR15_ARATH Pentatricopeptide repeat-containing protein At1g06143	30.700%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card