Gene Card
Gene overview
cDNA / CDS / Protein Sequences
939 bp · TkAUNG040830|TK1151|cDNA
ATGGCCAGTGTATGGCAGAGATACGACAGATTTTGGCAGAGCATGACAATTGAAGCGCAGTTTGTGGACAGTTTGTCCAAAGGCCTTCAAGTGGGAGATTGTTGGGTTGAAGACCCTTTTGACAATAAAGCTTGCATGAGATATTTTGAAGCATGCAAGTTGGCAAATTATTTTCAGTCCTATTATTCCGCAAGTTCCGATAGACTCGTACCTTATTTATCAGTGACTCGGTTGTTGGGTCCCAAGGCCTTGTACCAGAT...
939 bp · TkAUNG040830|TK1151|CDS
ATGGCCAGTGTATGGCAGAGATACGACAGATTTTGGCAGAGCATGACAATTGAAGCGCAGTTTGTGGACAGTTTGTCCAAAGGCCTTCAAGTGGGAGATTGTTGGGTTGAAGACCCTTTTGACAATAAAGCTTGCATGAGATATTTTGAAGCATGCAAGTTGGCAAATTATTTTCAGTCCTATTATTCCGCAAGTTCCGATAGACTCGTACCTTATTTATCAGTGACTCGGTTGTTGGGTCCCAAGGCCTTGTACCAGAT...
Protein
Download Protein FASTA312 aa · TkAUNG040830|TK1151|PROTEIN
MASVWQRYDRFWQSMTIEAQFVDSLSKGLQVGDCWVEDPFDNKACMRYFEACKLANYFQSYYSASSDRLVPYLSVTRLLGPKALYQMIMERKFQPVIIFSFSRRECEQHAMSMIKLDFNSQEEKDIVEQVFKNAIMCLSEEDRNLPAIELMLPLLQRGIAVHHSGLLPIIKELVELLFQEGLVKALFATETFAMGLNMPAKTVVFTSVRKWDGDSHRYVGSGEYIQMSGRAGRRGKDERGICIIMIDEQDMVLGKPAPLV...
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | TkAUNG040830 |
|---|---|
| TK1151 ID | TkAUNG040830 |
| OH-1004 ID | LXL04_001312 |
| Relationship / confidence | Non Reciprocal Best Hit / Complex relationship |
| Protein identity (%) | 57.600 |
| Protein coverage (%) | TK1151 69.551 / OH-1004 22.178Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | TK1151 / GWHBCHF00000000 |
SNP / Indel variants and carrier samplesCRA009020 · TK1151
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | TkAUNG040830 | |||||||||
|---|---|---|---|---|---|---|---|---|---|---|
| Location | ChrUn:11378246-11380271 (+) | |||||||||
| Description | Similar to MTR4: DExH-box ATP-dependent RNA helicase DExH9 | |||||||||
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene Arabidopsis
RiceNo hit for this species in the current source table. | |||||||||
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · | |||||||||
| GO annotations (OH1004 source) | GO:0000292 RNA fragment catabolic process Biological Process GO:0000398 mRNA splicing, via spliceosome Biological Process GO:0000460 maturation of 5.8S rRNA Biological Process GO:0000467 exonucleolytic trimming to generate mature 3'-end of 5.8S rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA) Biological Process GO:0006364 rRNA processing Biological Process GO:0006397 mRNA processing Biological Process GO:0006401 RNA catabolic process Biological Process GO:0006974 DNA damage response Biological Process GO:0008380 RNA splicing Biological Process GO:0016075 rRNA catabolic process Biological Process GO:0016076 snRNA catabolic process Biological Process GO:0031125 rRNA 3'-end processing Biological Process | |||||||||
| KEGG gene cross-reference | ath:AT1G59760 hsa:23517 mmu:72198 sce:YJL050W These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF00271Helicase_C82-114 aaPF30232aq_1631117-177 aaPF00271Helicase_C133-235 aaPF21408MTR4-like_stalk284-298 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| TkAUNG040830 | PF00271 | Helicase_C | 82 | 114 | 3.6e-10 | 40.8 |
| TkAUNG040830 | PF30232 | aq_1631 | 117 | 177 | 0.13 | 12.5 |
| TkAUNG040830 | PF00271 | Helicase_C | 133 | 235 | 3.6e-10 | 40.8 |
| TkAUNG040830 | PF21408 | MTR4-like_stalk | 284 | 298 | 0.094 | 13.7 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.