TkAUNG039380 | RubberDandelionOmics

Gene overview

TkAUNG039380

Reference: TK1151 Chr: ChrUn Coordinates: 10988195-10988842 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

390 bp · TkAUNG039380|TK1151|cDNA

ATGGAAGTCTCCGGTGCTGTTGATAAACACCCCGTAGGAGAAGACATCGGGAAGGTTTGCGGCATGGAAGAACCCCTAGAGATTCCCATAATCAGCGATCTCACCATGGTTCTAGGTTCCATATCTCAGATCGAAAAGAAAAAAGCAGCGCATAGAAAGATCAGAAACAAGCAACATCTAAATCGCTCTCTGATTCAAATATTAAAGGCAATCAAAGAAGAAGAAATCCTAACCTTAGCGAGATTAAGTTCTGCATTACT...

CDS

Download CDS FASTA

390 bp · TkAUNG039380|TK1151|CDS

ATGGAAGTCTCCGGTGCTGTTGATAAACACCCCGTAGGAGAAGACATCGGGAAGGTTTGCGGCATGGAAGAACCCCTAGAGATTCCCATAATCAGCGATCTCACCATGGTTCTAGGTTCCATATCTCAGATCGAAAAGAAAAAAGCAGCGCATAGAAAGATCAGAAACAAGCAACATCTAAATCGCTCTCTGATTCAAATATTAAAGGCAATCAAAGAAGAAGAAATCCTAACCTTAGCGAGATTAAGTTCTGCATTACT...

Protein

Download Protein FASTA

129 aa · TkAUNG039380|TK1151|PROTEIN

MEVSGAVDKHPVGEDIGKVCGMEEPLEIPIISDLTMVLGSISQIEKKKAAHRKIRNKQHLNRSLIQILKAIKEEEILTLARLSSALLCSSMATMKCLEGGTRTKNSGCGARQNTKGSHKMAGETGKPTL

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkAUNG039380`
TK1151 ID	TkAUNG039380
OH-1004 ID	LXL04_016609
Relationship / confidence	Rbh High Identity Coverage Local Synteny Minor Chr Pair / Probable
Protein identity (%)	96.900
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkAUNG039380

Location ChrUn:10988195-10988842 (+)

Description Similar to DAPB3: Dihydrodipicolinate reductase-like protein CRR1, chloroplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g52100`	Dihydrodipicolinate reductase (DHPR)-like protein that may not function as DHPR in lysine biosynthesis.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_016609 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0009089 L-lysine biosynthetic process via diaminopimelate Biological Process

GO:0019684 photosynthesis, light reaction Biological Process

GO:0019877 diaminopimelate biosynthetic process Biological Process

GO:0009507 chloroplast Cellular Component

GO:0009570 chloroplast stroma Cellular Component

GO:0008839 4-hydroxy-tetrahydrodipicolinate reductase activity Molecular Function

KEGG gene cross-reference

ath:AT5G52100

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.381

Rank 1 · TkAUNG039380 · TK1151

Cytoplasm0.381

Rank 2 · TkAUNG039380 · TK1151

Mitochondrion0.188

Rank 3 · TkAUNG039380 · TK1151

Cell membrane0.113

Rank 4 · TkAUNG039380 · TK1151

Endoplasmic reticulum0.051

Rank 5 · TkAUNG039380 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF12228DUF360415-78 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkAUNG039380	`PF12228`	DUF3604	15	78	0.23	10.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FJ82`	Arabidopsis thaliana	sp\|Q9FJ82\|DAPB3_ARATH Dihydrodipicolinate reductase-like protein CRR1, chloroplastic	79.100%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card