TkAUNG034180 | RubberDandelionOmics

Gene overview

TkAUNG034180

Reference: TK1151 Chr: ChrUn Coordinates: 9235340-9238319 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

996 bp · TkAUNG034180|TK1151|cDNA

ATGTCTGGTGTTTGGGTGTTCAAGAATGGTATGCTTCAAATGATGGAGAACAATGGAAGTGATTCCTTTCAGGGTTCTAGTCGACGTAAGGTGTTGGTTCATGTATCCACGACGGAAGTGGTGACTTCATATGAGGTTCTCGAGAGAATCTTATTTTCATGCGGATGGGAGAGGTACTACGATGATCCTGACCTATTTCAGTTTCATAAAAGGTCAAATGTGCATCTAATTTCTCTCCCTAAAGATTTCAACAAGTTCAA...

CDS

Download CDS FASTA

996 bp · TkAUNG034180|TK1151|CDS

ATGTCTGGTGTTTGGGTGTTCAAGAATGGTATGCTTCAAATGATGGAGAACAATGGAAGTGATTCCTTTCAGGGTTCTAGTCGACGTAAGGTGTTGGTTCATGTATCCACGACGGAAGTGGTGACTTCATATGAGGTTCTCGAGAGAATCTTATTTTCATGCGGATGGGAGAGGTACTACGATGATCCTGACCTATTTCAGTTTCATAAAAGGTCAAATGTGCATCTAATTTCTCTCCCTAAAGATTTCAACAAGTTCAA...

Protein

Download Protein FASTA

331 aa · TkAUNG034180|TK1151|PROTEIN

MSGVWVFKNGMLQMMENNGSDSFQGSSRRKVLVHVSTTEVVTSYEVLERILFSCGWERYYDDPDLFQFHKRSNVHLISLPKDFNKFKSMHMYDIVVKNRNVFEVFSGLVNGSGGLEEPLSAVVSWETNTHIGRICFKETVMSGSAENQKKETNPQGTPTITMPVNHGEKPKKFSGLHFKRWQQKMFFYLTTLKLARFLTEEAPQIPDGVGNVQAVSALDAWKHSDFLYAGAKNKKIQKKGNGAHLGAKCGNFKKKFQGNC...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkAUNG034180`
TK1151 ID	TkAUNG034180
OH-1004 ID	LXL04_036339
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	51.300
Protein coverage (%)	TK1151 99.094 / OH-1004 15.903 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkAUNG034180

Location ChrUn:9235340-9238319 (+)

Description Similar to Retrovirus-related Pol polyprotein from transposon TNT 1-94

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g24860`	Modulates the competence to flowering of apical meristems.	FPF1 modulates the competence to flowering in Arabidopsis.1999 · DOI: 10.1046/j.1365-313x.1999.00461.x FPF1 promotes flowering in Arabidopsis.1997 · DOI: 10.1105/tpc.9.8.1327
`At5g10625`	Modulates the competence to flowering of apical meristems.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os02g0460200`	Flowering-promoting factor 1-like protein 3.	No verified direct reference in this release
`Os04g0282400`	Flowering-promoting factor 1-like protein 4.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_036339 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006310 DNA recombination Biological Process

GO:0006508 proteolysis Biological Process

GO:0015074 DNA integration Biological Process

GO:0003676 nucleic acid binding Molecular Function

GO:0003964 RNA-directed DNA polymerase activity Molecular Function

GO:0004190 aspartic-type endopeptidase activity Molecular Function

GO:0004519 endonuclease activity Molecular Function

GO:0008270 zinc ion binding Molecular Function

KEGG gene cross-reference No functional description available

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.464

Rank 1 · TkAUNG034180 · TK1151

Nucleus0.300

Rank 2 · TkAUNG034180 · TK1151

Cell membrane0.148

Rank 3 · TkAUNG034180 · TK1151

Endoplasmic reticulum0.102

Rank 4 · TkAUNG034180 · TK1151

Mitochondrion0.085

Rank 5 · TkAUNG034180 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF22936Pol_BBD81-103 aa

PF22936Pol_BBD316-331 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkAUNG034180	`PF22936`	Pol_BBD	81	103	0.017	16.2
TkAUNG034180	`PF22936`	Pol_BBD	316	331	0.017	16.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`O23624`	Arabidopsis thaliana	sp\|O23624\|FPF1_ARATH Flowering-promoting factor 1	59.400%	Swiss-Prot	Low
`Q9LXB5`	Arabidopsis thaliana	sp\|Q9LXB5\|FLP2_ARATH Flowering-promoting factor 1-like protein 2	58.300%	Swiss-Prot	Low
`Q0E1D7`	Oryza sativa subsp. japonica	sp\|Q0E1D7\|FLP3_ORYSJ Flowering-promoting factor 1-like protein 3	60.900%	Swiss-Prot	Low
`Q0JEF5`	Oryza sativa subsp. japonica	sp\|Q0JEF5\|FLP4_ORYSJ Flowering-promoting factor 1-like protein 4	57.400%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card