TkAUNG034160 | RubberDandelionOmics

Gene overview

TkAUNG034160

Reference: TK1151 Chr: ChrUn Coordinates: 9223607-9223918 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

312 bp · TkAUNG034160|TK1151|cDNA

ATGGCTGGTTTTTGGGTGTTCAAGAATGGTGTGCTTCGGTTGGTGGAGAACACCGGAAGTGATTCCTTTCAGGGTTGTAGTCGACGTAAGGTGTTGGTTCATGTAGACACAAACGAAATGGTGACTTCGTATGTGGTGCTGGAAAGAATCTTATTGGCATGCGGATGGGAGAGGTACTACGATGATCCTGACCTATTTCAGTTTCATAAAAGGTCAAATGTGCACCTAATTTCTCTCCCTAAAGATTTCAACAAGTTCAA...

CDS

Download CDS FASTA

312 bp · TkAUNG034160|TK1151|CDS

ATGGCTGGTTTTTGGGTGTTCAAGAATGGTGTGCTTCGGTTGGTGGAGAACACCGGAAGTGATTCCTTTCAGGGTTGTAGTCGACGTAAGGTGTTGGTTCATGTAGACACAAACGAAATGGTGACTTCGTATGTGGTGCTGGAAAGAATCTTATTGGCATGCGGATGGGAGAGGTACTACGATGATCCTGACCTATTTCAGTTTCATAAAAGGTCAAATGTGCACCTAATTTCTCTCCCTAAAGATTTCAACAAGTTCAA...

Protein

Download Protein FASTA

103 aa · TkAUNG034160|TK1151|PROTEIN

MAGFWVFKNGVLRLVENTGSDSFQGCSRRKVLVHVDTNEMVTSYVVLERILLACGWERYYDDPDLFQFHKRSNVHLISLPKDFNKFKSMHMYERVVKNRNVFE

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkAUNG034160`
TK1151 ID	TkAUNG034160
OH-1004 ID	LXL04_036342
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	98.100
Protein coverage (%)	TK1151 100.000 / OH-1004 94.495 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkAUNG034160

Location ChrUn:9223607-9223918 (+)

Description Similar to Os02g0460200: Flowering-promoting factor 1-like protein 3

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g24860`	Modulates the competence to flowering of apical meristems.	FPF1 modulates the competence to flowering in Arabidopsis.1999 · DOI: 10.1046/j.1365-313x.1999.00461.x FPF1 promotes flowering in Arabidopsis.1997 · DOI: 10.1105/tpc.9.8.1327
`At5g10625`	Modulates the competence to flowering of apical meristems.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os02g0460200`	Flowering-promoting factor 1-like protein 3.	No verified direct reference in this release
`Os01g0257300`	GTP-binding protein that functions in the development of root systems, which are mediated by auxin.	Overexpression of OsRAA1 causes pleiotropic phenotypes in transgenic rice plants, including altered leaf, flower, and root development and root response to gravity.2004 · DOI: 10.1104/pp.104.041996 Biochemical character of the purified OsRAA1, a novel rice protein with GTP-binding activity, and its expression pattern in Oryza sativa.2005 · DOI: 10.1016/j.jplph.2004.12.001 Rice ROOT ARCHITECTURE ASSOCIATED1 binds the proteasome subunit RPT4 and is degraded in a D-box and proteasome-dependent manner.2008 · DOI: 10.1104/pp.108.125294

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_036342 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0009733 response to auxin Biological Process

GO:0009909 regulation of flower development Biological Process

GO:0009911 positive regulation of flower development Biological Process

GO:0010228 vegetative to reproductive phase transition of meristem Biological Process

GO:0045841 negative regulation of mitotic metaphase/anaphase transition Biological Process

GO:2000280 regulation of root development Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0005525 GTP binding Molecular Function

KEGG gene cross-reference

ath:AT5G10625

ath:AT5G24860

dosa:Os01g0257300

dosa:Os02g0460200

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.546

Rank 1 · TkAUNG034160 · TK1151

Cytoplasm0.466

Rank 2 · TkAUNG034160 · TK1151

Mitochondrion0.063

Rank 3 · TkAUNG034160 · TK1151

Cell membrane0.044

Rank 4 · TkAUNG034160 · TK1151

Endoplasmic reticulum0.039

Rank 5 · TkAUNG034160 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF26213TYRAAT1_C11-24 aa

PF26213TYRAAT1_C64-88 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkAUNG034160	`PF26213`	TYRAAT1_C	11	24	0.1	13.0
TkAUNG034160	`PF26213`	TYRAAT1_C	64	88	0.1	13.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`O23624`	Arabidopsis thaliana	sp\|O23624\|FPF1_ARATH Flowering-promoting factor 1	57.700%	Swiss-Prot	High
`Q9LXB5`	Arabidopsis thaliana	sp\|Q9LXB5\|FLP2_ARATH Flowering-promoting factor 1-like protein 2	57.500%	Swiss-Prot	High
`Q0E1D7`	Oryza sativa subsp. japonica	sp\|Q0E1D7\|FLP3_ORYSJ Flowering-promoting factor 1-like protein 3	58.700%	Swiss-Prot	High
`Q9LGE3`	Oryza sativa subsp. japonica	sp\|Q9LGE3\|FLP1_ORYSJ Flowering-promoting factor 1-like protein 1	58.100%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card