TkAUNG031560 | RubberDandelionOmics

Gene overview

TkAUNG031560

Reference: TK1151 Chr: ChrUn Coordinates: 8486456-8492667 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

5170 bp · TkAUNG031560|TK1151|cDNA

GGAGTCTGGGGGCTAGGGCATCAATAGTAGTAACGCCCACTGCCACCGATATACCCTCTTCGCTTCACACTGATCACGTCGACACCGTTGCGTATCAATCTCTCCCAGAATTTCATAAACGAGGCCCAACGAGATCGTGGCTGGTCGTCTTCATTGTCATCAAGGTTTGTGTCGGTACACTGTGAATGCCCAATCGAGTGTTCTTCTGATGCAACATGGGTTTTGACAATGAGTGCATATTAAACATCCAATCTCTTGCT...

CDS

Download CDS FASTA

2943 bp · TkAUNG031560|TK1151|CDS

ATGGGTTTTGACAATGAGTGCATATTAAACATCCAATCTCTTGCTGGCGAATACTTTTGTCCTGTTTGTCGAACCCTAGTCTACCCCCATGAAGCACTCCAGACACAGTGCACTCATCTCTACTGCAAACCTTGTCTCACATACGTTGCAAGCAGTACTCAGGCCTGCCCTTATGATGGATACCTGGTAACCGAGTCTGGCTCAAAGCCACTGATGGAATCGAACAAGGCATTGGCGGAAACCATTGGGAAAACCAGTGT...

Protein

Download Protein FASTA

980 aa · TkAUNG031560|TK1151|PROTEIN

MGFDNECILNIQSLAGEYFCPVCRTLVYPHEALQTQCTHLYCKPCLTYVASSTQACPYDGYLVTESGSKPLMESNKALAETIGKTSVHCLYHRSGCVWQGPLSECTSHCSGCAFGNSPVVCNRCGIQIVHRQVQEHAQTCTVNGGANANSQPQGSESAQDTAAVDQSKIGNQAAPPASQPQPVAAVNQTPPTNPLPQVPPSTGVQPPPDQWYQQQYYQQYPGYDPFQQQQQQQTYQQYYPYQQQPPSQSQSQPQIQLPVQ...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkAUNG031560`
TK1151 ID	TkAUNG031560
OH-1004 ID	LXL04_036376
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	94.200
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkAUNG031560`
Location	ChrUn:8486456-8492667 (-)
Description	Protein of unknown function
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_036376` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0003300 cardiac muscle hypertrophy Biological Process GO:0006936 muscle contraction Biological Process GO:0010628 positive regulation of gene expression Biological Process GO:0035995 detection of muscle stretch Biological Process GO:0043056 forward locomotion Biological Process GO:0050714 positive regulation of protein secretion Biological Process GO:0051592 response to calcium ion Biological Process GO:0060048 cardiac muscle contraction Biological Process GO:1901897 regulation of relaxation of cardiac muscle Biological Process GO:0000794 condensed nuclear chromosome Cellular Component GO:0002020 protease binding Molecular Function GO:0004674 protein serine/threonine kinase activity Molecular Function
KEGG gene cross-reference	No functional description available

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.946

Rank 1 · TkAUNG031560 · TK1151

Cytoplasm0.185

Rank 2 · TkAUNG031560 · TK1151

Cell membrane0.018

Rank 3 · TkAUNG031560 · TK1151

Mitochondrion0.016

Rank 4 · TkAUNG031560 · TK1151

Endoplasmic reticulum0.014

Rank 5 · TkAUNG031560 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF13639zf-RING_23-24 aa

PF00097zf-C3HC45-23 aa

PF14634zf-RING_56-25 aa

PF18439zf_UBZ17-32 aa

PF00097zf-C3HC420-57 aa

PF14634zf-RING_520-57 aa

PF13639zf-RING_220-58 aa

PF13445zf-RING_UBOX20-57 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkAUNG031560	`PF13639`	zf-RING_2	3	24	0.012	16.6
TkAUNG031560	`PF00097`	zf-C3HC4	5	23	0.0034	17.9
TkAUNG031560	`PF14634`	zf-RING_5	6	25	0.0037	17.9
TkAUNG031560	`PF18439`	zf_UBZ	17	32	0.043	14.2
TkAUNG031560	`PF00097`	zf-C3HC4	20	57	0.0034	17.9
TkAUNG031560	`PF14634`	zf-RING_5	20	57	0.0037	17.9
TkAUNG031560	`PF13639`	zf-RING_2	20	58	0.012	16.6
TkAUNG031560	`PF13445`	zf-RING_UBOX	20	57	0.019	15.7
TkAUNG031560	`PF13923`	zf-C3HC4_2	20	57	1.1	9.8
TkAUNG031560	`PF02176`	zf-TRAF	83	108	1.8	10.1
TkAUNG031560	`PF13639`	zf-RING_2	109	112	0.012	16.6
TkAUNG031560	`PF02176`	zf-TRAF	117	141	1.8	10.1
TkAUNG031560	`PF18439`	zf_UBZ	119	136	0.043	14.2
TkAUNG031560	`PF13923`	zf-C3HC4_2	120	128	1.1	9.8
TkAUNG031560	`PF00097`	zf-C3HC4	121	130	0.0034	17.9
TkAUNG031560	`PF14634`	zf-RING_5	121	125	0.0037	17.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card