TkAUNG030560 | RubberDandelionOmics

Gene overview

TkAUNG030560

Reference: TK1151 Chr: ChrUn Coordinates: 8239052-8240671 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

681 bp · TkAUNG030560|TK1151|cDNA

ATGTCAAGTGGGGGTTCACAGAGCAGTTTAAGAAAAACACTTGGTGCTCTGAAGGATAGCACCACTGTTAGTTTGGCGAAAATTAACAGTGACTACAAGGAACTGGACATTGCCATTGTTAAGGCTACAAATCATGTTGAACGCCCTGCAAAAGAGAGGCATATAAGAGCCGTCTTTGCTGCCATATCGGCCACCAGGCCTCGTGCTGATGTTGCCTATTGCATACATGCCCTTGCCAGAAGATTGTCTAAAACTCATAA...

CDS

Download CDS FASTA

681 bp · TkAUNG030560|TK1151|CDS

ATGTCAAGTGGGGGTTCACAGAGCAGTTTAAGAAAAACACTTGGTGCTCTGAAGGATAGCACCACTGTTAGTTTGGCGAAAATTAACAGTGACTACAAGGAACTGGACATTGCCATTGTTAAGGCTACAAATCATGTTGAACGCCCTGCAAAAGAGAGGCATATAAGAGCCGTCTTTGCTGCCATATCGGCCACCAGGCCTCGTGCTGATGTTGCCTATTGCATACATGCCCTTGCCAGAAGATTGTCTAAAACTCATAA...

Protein

Download Protein FASTA

226 aa · TkAUNG030560|TK1151|PROTEIN

MSSGGSQSSLRKTLGALKDSTTVSLAKINSDYKELDIAIVKATNHVERPAKERHIRAVFAAISATRPRADVAYCIHALARRLSKTHNWAVALKTLIVIHRALREVDPTFQEEIINYGRSRGHMLNLAHFKDDSSPNAWDYSTWVRSYALFLEERLECFRVLKYDIETDRLRTKDLDTPELLEQLPALQELLHRVLGCLPHGAAVHNLSFNWPFRWLLWKASKFTTQ

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkAUNG030560`
TK1151 ID	TkAUNG030560
OH-1004 ID	LXL04_002735
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	85.400
Protein coverage (%)	TK1151 91.150 / OH-1004 22.563 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkAUNG030560

Location ChrUn:8239052-8240671 (+)

Description Similar to At5g35200: Putative clathrin assembly protein At5g35200

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g35200`	Putative clathrin assembly protein At5g35200.	No verified direct reference in this release
`At2g01600`	Putative clathrin assembly protein At2g01600.	No verified direct reference in this release
`At5g57200`	Putative clathrin assembly protein At5g57200.	No verified direct reference in this release
`At4g25940`	Putative clathrin assembly protein At4g25940.	No verified direct reference in this release
`At1g14910`	Putative clathrin assembly protein At1g14910.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_002735 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006900 vesicle budding from membrane Biological Process

GO:0048268 clathrin coat assembly Biological Process

GO:0072583 clathrin-dependent endocytosis Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0005794 Golgi apparatus Cellular Component

GO:0005829 cytosol Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0005905 clathrin-coated pit Cellular Component

GO:0009536 plastid Cellular Component

GO:0030136 clathrin-coated vesicle Cellular Component

KEGG gene cross-reference

ath:AT1G14910

ath:AT2G01600

ath:AT4G25940

ath:AT5G35200

ath:AT5G57200

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.403

Rank 1 · TkAUNG030560 · TK1151

Cytoplasm0.335

Rank 2 · TkAUNG030560 · TK1151

Nucleus0.197

Rank 3 · TkAUNG030560 · TK1151

Endoplasmic reticulum0.118

Rank 4 · TkAUNG030560 · TK1151

Golgi apparatus0.115

Rank 5 · TkAUNG030560 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF26715HEAT_GCN1_29-115 aa

PF01417ENTH32-115 aa

PF07651ANTH34-216 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkAUNG030560	`PF26715`	HEAT_GCN1_2	9	115	0.15	12.7
TkAUNG030560	`PF01417`	ENTH	32	115	0.0073	17.1
TkAUNG030560	`PF07651`	ANTH	34	216	5.7e-50	170.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LHS0`	Arabidopsis thaliana	sp\|Q9LHS0\|CAP10_ARATH Putative clathrin assembly protein At5g35200	84.700%	Swiss-Prot	High
`Q8LBH2`	Arabidopsis thaliana	sp\|Q8LBH2\|CAP8_ARATH Putative clathrin assembly protein At2g01600	66.800%	Swiss-Prot	High
`Q9LVD8`	Arabidopsis thaliana	sp\|Q9LVD8\|CAP7_ARATH Putative clathrin assembly protein At5g57200	64.800%	Swiss-Prot	High
`Q8VYT2`	Arabidopsis thaliana	sp\|Q8VYT2\|CAP6_ARATH Putative clathrin assembly protein At4g25940	63.100%	Swiss-Prot	High
`P94017`	Arabidopsis thaliana	sp\|P94017\|CAP9_ARATH Putative clathrin assembly protein At1g14910	64.000%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card