TkAUNG029320 | RubberDandelionOmics

Gene overview

TkAUNG029320

Reference: TK1151 Chr: ChrUn Coordinates: 7913629-7917616 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1977 bp · TkAUNG029320|TK1151|cDNA

CTCACTTCTGTTGGAAGTCCCTTCCCTGCAAAGAGAAGAGAGTATCGTATAATCGTATATATGGGAGTAGAGAGAGAGAGAGAGAGAGAGAGAGAGAGAGAGAGAGAGAGAGAGAGCGCAAAAAACCAGCGGGATAAATAAAGAAAGGTCCAAACTAGAATAAGTACAGGCTACCTCTTTATATATTCTGAAAGCATCTCTCTATCTCTCCCTCTGTTCTTCAGAGCTAAAATTTCAAAATTACCTGTGTTATTGGATTT...

CDS

Download CDS FASTA

1119 bp · TkAUNG029320|TK1151|CDS

ATGAAAGAAAAAATGGCTACGAAAAACAGAGGAGATCAGCAATCTTCAAGAAGCGTTATATCCCCAAAATGGACGTTTTTATTATGTATCAGCAGTTTCTGTGCTGGATTACTCTTCACAAATAGAACGTGGACGGTGTCTGACTCTAAACTTATTACAAGACCAACTGGTTTAGAATCTGAAGGCCTCAAGTTGGTATCAGAAGGTTGTGATCTAAGGAAGTTACAAATGAAGAACGTAAAGCGCGATTCTAAACAAAT...

Protein

Download Protein FASTA

372 aa · TkAUNG029320|TK1151|PROTEIN

MKEKMATKNRGDQQSSRSVISPKWTFLLCISSFCAGLLFTNRTWTVSDSKLITRPTGLESEGLKLVSEGCDLRKLQMKNVKRDSKQIFGEVSKTHQAIQTLDKTISSLEMELAAARSIQESIVNGSPISQDETTSAPERRKYLMVVGVNTAFSSRKRRDSIRATWMPQGDKRKKLEEEKGIIMRFVIGHSATVGGILDRAIEAEDRKHGDFLRLDHVEGYLELSAKTKTYFATAVTMWDAEFYIKVDDDVHVNIATLGHT...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkAUNG029320`
TK1151 ID	TkAUNG029320
OH-1004 ID	LXL04_038189
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	98.800
Protein coverage (%)	TK1151 87.634 / OH-1004 79.319 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkAUNG029320

Location ChrUn:7913629-7917616 (+)

Description Similar to B3GALT2: Probable beta-1,3-galactosyltransferase 2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g32430`	Beta-1,3-galactosyltransferase that transfers galactose from UDP-galactose to substrates with a terminal glycosyl residue.	No verified direct reference in this release
`At1g05170`	Beta-1,3-galactosyltransferase that transfers galactose from UDP-galactose to substrates with a terminal glycosyl residue.	No verified direct reference in this release
`At4g26940`	Beta-1,3-galactosyltransferase that transfers galactose from UDP-galactose to substrates with a terminal glycosyl residue.	No verified direct reference in this release
`At1g11730`	Beta-1,3-galactosyltransferase that transfers galactose from UDP-galactose to substrates with a terminal glycosyl residue.	No verified direct reference in this release
`At1g32930`	Beta-galactosyltransferase involved in elongation of beta-1,6-linked galactan side chains on arabinogalactan proteins.	A galactosyltransferase acting on arabinogalactan protein glycans is essential for embryo development in Arabidopsis.2013 · DOI: 10.1111/tpj.12281 Galactosyltransferases from Arabidopsis thaliana in the biosynthesis of type II arabinogalactan: molecular interaction enhances enzyme activity.2014 · DOI: 10.1186/1471-2229-14-90

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_038189 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0009101 glycoprotein biosynthetic process Biological Process

GO:0009793 embryo development ending in seed dormancy Biological Process

GO:0030244 cellulose biosynthetic process Biological Process

GO:0000139 Golgi membrane Cellular Component

GO:0005794 Golgi apparatus Cellular Component

GO:0008378 galactosyltransferase activity Molecular Function

KEGG gene cross-reference

ath:AT1G05170

ath:AT1G11730

ath:AT1G32930

ath:AT2G32430

ath:AT4G26940

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Golgi apparatus0.793

Rank 1 · TkAUNG029320 · TK1151

Endoplasmic reticulum0.107

Rank 2 · TkAUNG029320 · TK1151

Cytoplasm0.063

Rank 3 · TkAUNG029320 · TK1151

Cell membrane0.055

Rank 4 · TkAUNG029320 · TK1151

Extracellular0.054

Rank 5 · TkAUNG029320 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF13334DUF409421-117 aa

PF30355zf_C2H2-Disco145-160 aa

PF01762Galactosyl_T156-327 aa

PF02434Fringe221-296 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkAUNG029320	`PF13334`	DUF4094	21	117	2.7e-35	121.4
TkAUNG029320	`PF30355`	zf_C2H2-Disco	145	160	0.076	13.8
TkAUNG029320	`PF01762`	Galactosyl_T	156	327	1.7e-44	152.7
TkAUNG029320	`PF02434`	Fringe	221	296	0.00011	22.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9ZV71`	Arabidopsis thaliana	sp\|Q9ZV71\|B3GT3_ARATH Probable beta-1,3-galactosyltransferase 3	76.500%	Swiss-Prot	High
`A8MRC7`	Arabidopsis thaliana	sp\|A8MRC7\|B3GT2_ARATH Probable beta-1,3-galactosyltransferase 2	75.500%	Swiss-Prot	High
`Q8LEJ9`	Arabidopsis thaliana	sp\|Q8LEJ9\|B3GT4_ARATH Probable beta-1,3-galactosyltransferase 4	71.200%	Swiss-Prot	High
`Q9SAA4`	Arabidopsis thaliana	sp\|Q9SAA4\|B3GT1_ARATH Probable beta-1,3-galactosyltransferase 1	58.700%	Swiss-Prot	High
`Q9MAP8`	Arabidopsis thaliana	sp\|Q9MAP8\|B3GT6_ARATH Beta-1,6-galactosyltransferase GALT31A	57.800%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card