TkAUNG027610 | RubberDandelionOmics

Gene overview

TkAUNG027610

Reference: TK1151 Chr: ChrUn Coordinates: 7381426-7383873 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1322 bp · TkAUNG027610|TK1151|cDNA

GTTTTTATATAAAATACTATTTATTTAATAATTTTATTTTAGTGAAAATTTGGGCTAAGGTGATATGTGAACTAACAGTACACATTCATAGACACACGGCAACACAGATCGGCCATGAGTTGCATGATCCCCAAGTCGACTTCTGCTGGATCTTCTCGCCCGAAATTTGTGATGTCGACCAAAGCATGGTTTTGCACGGCGTCGCCGTCGCGGCTGCTCTCTCGTCGGCGCTCACGCATACTTCTATTACCGCCGATCTG...

CDS

Download CDS FASTA

357 bp · TkAUNG027610|TK1151|CDS

ATGAGTTGCATGATCCCCAAGTCGACTTCTGCTGGATCTTCTCGCCCGAAATTTGTGATGTCGACCAAAGCATGGTTTTGCACGGCGTCGCCGTCGCGGCTGCTCTCTCGTCGGCGCTCACGCATACTTCTATTACCGCCGATCTGCCACCATTTTTCGGAGTCGAGTTGTGGGCATAATTCCAGCTCGGTTCGCTTCTTCCGATTTCAGGGCAAACCCCTCGTTGAGATCCTCGGCAAACCCATGATCCAGAGAACTTG...

Protein

Download Protein FASTA

118 aa · TkAUNG027610|TK1151|PROTEIN

MSCMIPKSTSAGSSRPKFVMSTKAWFCTASPSRLLSRRRSRILLLPPICHHFSESSCGHNSSSVRFFRFQGKPLVEILGKPMIQRTWERAKLATTLDRVVVATDDEKMQNAVVDSVLM

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkAUNG027610`
TK1151 ID	TkAUNG027610
OH-1004 ID	LXL04_037632
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	53.300
Protein coverage (%)	TK1151 71.186 / OH-1004 27.632 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkAUNG027610

Location ChrUn:7381426-7383873 (-)

Description Similar to KDSB: 3-deoxy-manno-octulosonate cytidylyltransferase, mitochondrial

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g53000`	Catalyzes the production of the sugar nucleotide CMP-3-deoxy-D-manno-octulosonate (CMP-KDO).	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_037632 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0009555 pollen development Biological Process

GO:0009860 pollen tube growth Biological Process

GO:0033468 CMP-keto-3-deoxy-D-manno-octulosonic acid biosynthetic process Biological Process

GO:0071555 cell wall organization Biological Process

GO:0005634 nucleus Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0005741 mitochondrial outer membrane Cellular Component

GO:0005829 cytosol Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0016020 membrane Cellular Component

GO:0008690 3-deoxy-manno-octulosonate cytidylyltransferase activity Molecular Function

KEGG gene cross-reference

ath:AT1G53000

cmu:TC_0454

fnu:FN0807

pcu:PC_RS03970

zma:542667

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.266

Rank 1 · TkAUNG027610 · TK1151

Nucleus0.242

Rank 2 · TkAUNG027610 · TK1151

Cytoplasm0.225

Rank 3 · TkAUNG027610 · TK1151

Mitochondrion0.210

Rank 4 · TkAUNG027610 · TK1151

Cell membrane0.061

Rank 5 · TkAUNG027610 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF14642FAM4719-48 aa

PF02934GatB_N61-105 aa

PF12804NTP_transf_365-111 aa

PF02348CTP_transf_368-114 aa

PF00483NTP_transferase71-106 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkAUNG027610	`PF14642`	FAM47	19	48	0.11	12.7
TkAUNG027610	`PF02934`	GatB_N	61	105	0.11	12.3
TkAUNG027610	`PF12804`	NTP_transf_3	65	111	0.00054	20.9
TkAUNG027610	`PF02348`	CTP_transf_3	68	114	3.4e-12	47.3
TkAUNG027610	`PF00483`	NTP_transferase	71	106	0.065	13.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9C920`	Arabidopsis thaliana	sp\|Q9C920\|KDSB_ARATH 3-deoxy-manno-octulosonate cytidylyltransferase, mitochondrial	82.900%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card