Gene Card
Gene overview
cDNA / CDS / Protein Sequences
1789 bp · TkAUNG026770|TK1151|cDNA
CTTTGCCGTTTCCAGGACCTACGGGTTTCTTTTCCGGGAAGCTTTCTTCTTCTGTTGTTGCGTCGTCGGCGTTACAAATCAATCAAACGGAAAAAAGTGTATATCGATGCAAAAGGTTTGTAAAATCGAGTGATTGCTGATGTGGAGGTGGATGGTAAGGAGAACGAAGGTGGTAATGGCGGTGGTAAGAAGAGGAACCGTCTATGGAGGCGGTGGGGAATTATTGGAGCTCTGATCGCTGTTTTAGTTGCCATATGTCT...
819 bp · TkAUNG026770|TK1151|CDS
ATGACGTATGTAAATCTGTTATTGAACCCTGAACATCATACGAGATACACAGGGCCATCAGCAAGAAGAATATGGGATGCTATTTATTCAGAACATTGTCCAAGATATGCGTATGGGGAAATGTGCCCGGAGAAGAAAGTACTATACAAACTAATATCCGGTCTTCACTCCTCAATCTCTATCCACATAGCCGCCGATTATCTTTTTCACGTAACCAAAAACAAGCGGGGTCAAAATCTTGAATTGATGCACGATCGTGT...
Protein
Download Protein FASTA272 aa · TkAUNG026770|TK1151|PROTEIN
MTYVNLLLNPEHHTRYTGPSARRIWDAIYSEHCPRYAYGEMCPEKKVLYKLISGLHSSISIHIAADYLFHVTKNKRGQNLELMHDRVLKHPDRVQNLYFTFLFVLRAVTKAGGYLEQAEYDSGNFLEDVKAQYLITRIVQNPKLQAACALPFNEAELWQGKGGPDLRQQIQNQFRNISALMECVGCEKCRLWGKLQVLGIGTALKILFSVGNPDPHLMLQRNEVIALVNLLNRLSESLVLVNQMGTTAKEIRPWGLSMAY...
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | TkAUNG026770 |
|---|---|
| TK1151 ID | TkAUNG026770 |
| OH-1004 ID | LXL04_037893 |
| Relationship / confidence | Sequence Supported Annotation Or Model Conflict / Review |
| Protein identity (%) | 100.000 |
| Protein coverage (%) | TK1151 100.000 / OH-1004 58.495Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | TK1151 / GWHBCHF00000000 |
SNP / Indel variants and carrier samplesCRA009020 · TK1151
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | TkAUNG026770 | |||||||||
|---|---|---|---|---|---|---|---|---|---|---|
| Location | ChrUn:7171713-7174723 (+) | |||||||||
| Description | Similar to AERO1: Endoplasmic reticulum oxidoreductin-1 | |||||||||
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene Arabidopsis
RiceNo hit for this species in the current source table. | |||||||||
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · | |||||||||
| GO annotations (OH1004 source) | GO:0006457 protein folding Biological Process GO:0018401 peptidyl-proline hydroxylation to 4-hydroxy-L-proline Biological Process GO:0030070 insulin processing Biological Process GO:0030198 extracellular matrix organization Biological Process GO:0034975 protein folding in endoplasmic reticulum Biological Process GO:0034976 response to endoplasmic reticulum stress Biological Process GO:0042593 glucose homeostasis Biological Process GO:0045454 cell redox homeostasis Biological Process GO:0051209 release of sequestered calcium ion into cytosol Biological Process GO:0051604 protein maturation Biological Process GO:0005615 extracellular space Cellular Component GO:0005634 nucleus Cellular Component | |||||||||
| KEGG gene cross-reference | ath:AT1G72280 ath:AT2G38960 bta:100125317 hsa:56605 mmu:67475 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF04137ERO11-238 aaPF10734DUF252352-65 aaPF10734DUF252397-118 aaPF10734DUF2523166-209 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| TkAUNG026770 | PF04137 | ERO1 | 1 | 238 | 6.5e-85 | 286.1 |
| TkAUNG026770 | PF10734 | DUF2523 | 52 | 65 | 0.12 | 13.6 |
| TkAUNG026770 | PF10734 | DUF2523 | 97 | 118 | 0.12 | 13.6 |
| TkAUNG026770 | PF10734 | DUF2523 | 166 | 209 | 0.12 | 13.6 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.