TkAUNG023970 | RubberDandelionOmics

Gene overview

TkAUNG023970

Reference: TK1151 Chr: ChrUn Coordinates: 6432271-6433203 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

933 bp · TkAUNG023970|TK1151|cDNA

ATGAGTTTCCATATAGAGGTCACTCAAACATCCCGATTTTTTCATAGACAAGTTAATAAAGCCCTAGTATTTCAAGAATTTGTCTACAACTACGCTGGCGGCACTACTAAGGACTTTTTATCATTCATTTTGTCCCTCATTTATCTGTGTTTATTAGCGTTTTGGGTGTTCACATGCCTCAAGAACCATGCATATGTTCACAAAATTCATATATTGATGGGTGCGTTGATTTTCACGGTGACACTTGACATGATATCTGG...

CDS

Download CDS FASTA

933 bp · TkAUNG023970|TK1151|CDS

ATGAGTTTCCATATAGAGGTCACTCAAACATCCCGATTTTTTCATAGACAAGTTAATAAAGCCCTAGTATTTCAAGAATTTGTCTACAACTACGCTGGCGGCACTACTAAGGACTTTTTATCATTCATTTTGTCCCTCATTTATCTGTGTTTATTAGCGTTTTGGGTGTTCACATGCCTCAAGAACCATGCATATGTTCACAAAATTCATATATTGATGGGTGCGTTGATTTTCACGGTGACACTTGACATGATATCTGG...

Protein

Download Protein FASTA

310 aa · TkAUNG023970|TK1151|PROTEIN

MSFHIEVTQTSRFFHRQVNKALVFQEFVYNYAGGTTKDFLSFILSLIYLCLLAFWVFTCLKNHAYVHKIHILMGALIFTVTLDMISGPAETECVKLISTRDGSYVVVYTYKFMRAVLFNTVVMLMDAGWSFFRPFVQVKEMMVLMVAILFNVGCVLARVTWGGYFSLVDIICSISLIKSISCTRNWLGNVWKDEANAKAARNFENIRVSAVISSLTINICRYGTCFMRTVGLISCNDEAPYVVQEVYSLVFYMLVFYNFR...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkAUNG023970`
TK1151 ID	TkAUNG023970
OH-1004 ID	LXL04_004912
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	37.000
Protein coverage (%)	TK1151 80.968 / OH-1004 62.329 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkAUNG023970`
Location	ChrUn:6432271-6433203 (+)
Description	Similar to CAND7: Protein CANDIDATE G-PROTEIN COUPLED RECEPTOR 7
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_004912` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0002237 response to molecule of bacterial origin Biological Process GO:0007186 G protein-coupled receptor signaling pathway Biological Process GO:0010015 root morphogenesis Biological Process GO:0034122 negative regulation of toll-like receptor signaling pathway Biological Process GO:0050776 regulation of immune response Biological Process GO:0072583 clathrin-dependent endocytosis Biological Process GO:0072659 protein localization to plasma membrane Biological Process GO:2001008 positive regulation of cellulose biosynthetic process Biological Process GO:0000139 Golgi membrane Cellular Component GO:0005654 nucleoplasm Cellular Component GO:0005769 early endosome Cellular Component GO:0005794 Golgi apparatus Cellular Component
KEGG gene cross-reference	ath:AT5G02630 ath:AT5G18520 hsa:56927 mmu:277463 rno:311857 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.301

Rank 1 · TkAUNG023970 · TK1151

Endoplasmic reticulum0.291

Rank 2 · TkAUNG023970 · TK1151

Cytoplasm0.225

Rank 3 · TkAUNG023970 · TK1151

Golgi apparatus0.209

Rank 4 · TkAUNG023970 · TK1151

Lysosome / Vacuole0.207

Rank 5 · TkAUNG023970 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF05393Hum_adeno_E3A27-64 aa

PF06814GOST_TM40-265 aa

PF05393Hum_adeno_E3A141-158 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkAUNG023970	`PF05393`	Hum_adeno_E3A	27	64	0.13	13.1
TkAUNG023970	`PF06814`	GOST_TM	40	265	9.6e-07	29.4
TkAUNG023970	`PF05393`	Hum_adeno_E3A	141	158	0.13	13.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card