TkAUNG020290 | RubberDandelionOmics

Gene overview

TkAUNG020290

Reference: TK1151 Chr: ChrUn Coordinates: 5446490-5449885 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1612 bp · TkAUNG020290|TK1151|cDNA

AAACACAATAACACACATCTCGGATTTTTGGAGAAATCGAATTCAGAAAGCATTTTACTGGCCTAAACTGGTGAAAATCTAGGTATCGTAATGAACATAAACATCAAATTCAAACCCACATCTCGGCTGCCCCTGCATTTGATTTCAGAGGATTTAAGACACGTGAGAAGCTTAATTCTCTAATTCAATATGGGGAGAAGAAAGAATTTCCATCAAAATTCAGAGATTCAAAAAAGTGGAAAATTATCTGTCGATTTTCA...

CDS

Download CDS FASTA

663 bp · TkAUNG020290|TK1151|CDS

ATGCAAAGCATTTGGGATTTCATGCATTCAAGAGCAGATTTCAAGGAAGCCCAAAGTGCAGCAATTTTTTCTTGGTCACTCCTTTTAAGTAGCATGGATAGTTGGACTCTTAGTTATAAACATTGGCGAGGGGCGATTCCTTTCTTTAAAAAGTTACTAGAGTCAGACAACGAGTCAATTGTCAATGGAGCTAGGCAAGCACTAGCCCTAATATTTGAAATTGGGTGTCTTGAAAAATTTGAAGATGACACGTCAGCAAT...

Protein

Download Protein FASTA

220 aa · TkAUNG020290|TK1151|PROTEIN

MQSIWDFMHSRADFKEAQSAAIFSWSLLLSSMDSWTLSYKHWRGAIPFFKKLLESDNESIVNGARQALALIFEIGCLEKFEDDTSAMEEINVEKILEDGHIPEISVKIGKQRLKVNTLPQQIQLNFVRRLLGSGFVVHMRENELLHDVFKFKPEKRQLEKKLYVAERDEVGINLFVPDVRSEDSFQRIHKSQNSIFVKARTQIRNKNRDIKGEEQGRCED

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkAUNG020290`
TK1151 ID	TkAUNG020290
OH-1004 ID	LXL04_025696
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 56.410 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkAUNG020290`
Location	ChrUn:5446490-5449885 (-)
Description	Similar to IFRD1: Interferon-related developmental regulator 1
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_025696` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0006417 regulation of translation Biological Process GO:0016055 Wnt signaling pathway Biological Process GO:0017148 negative regulation of translation Biological Process GO:0030154 cell differentiation Biological Process GO:0005634 nucleus Cellular Component GO:0005737 cytoplasm Cellular Component GO:0030371 translation repressor activity Molecular Function GO:0043022 ribosome binding Molecular Function
KEGG gene cross-reference	hsa:3475 mmu:15983 ssc:493185 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.444

Rank 1 · TkAUNG020290 · TK1151

Nucleus0.440

Rank 2 · TkAUNG020290 · TK1151

Cell membrane0.083

Rank 3 · TkAUNG020290 · TK1151

Golgi apparatus0.065

Rank 4 · TkAUNG020290 · TK1151

Lysosome / Vacuole0.062

Rank 5 · TkAUNG020290 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF05004IFRD17-89 aa

PF18172LepB_GAP_N129-155 aa

PF04836IFRD_C142-163 aa

PF04836IFRD_C190-209 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkAUNG020290	`PF05004`	IFRD	17	89	8.7e-11	42.0
TkAUNG020290	`PF18172`	LepB_GAP_N	129	155	0.069	13.6
TkAUNG020290	`PF04836`	IFRD_C	142	163	1.7e-08	35.6
TkAUNG020290	`PF04836`	IFRD_C	190	209	1.7e-08	35.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card